SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151LVZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151LVZ9
Domain Number 1 Region: 418-721
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-52
Family Duffy binding domain 0.000023
Further Details:      
 
Domain Number 2 Region: 107-395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-48
Family Duffy binding domain 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151LVZ9
Sequence length 931
Comment (tr|A0A151LVZ9|A0A151LVZ9_PLARE) Erythrocyte binding antigen-181 {ECO:0000313|EMBL:KYO03351.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRSY57_0100400 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGKMNMCLFFFYSLLYLILCAYVLGIGEEELKERPQGLNDKNNDNYNNNSKDLMSFANE
VVRFMENEKDVEEDKNVNIISGPVENTLNRYTGSSFLNIKKYGRKGEYLNRSSFFQRSYV
NGCQEKRKSHTWVCGNEGNDNICIPDRRVQLCITSLQDIKNSGSEKNDRELLKNKVFDSA
MYEADLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKIVEEALKRFFKKDS
SILNPHAWWQRYGTRLWKYMIKPYEHLGCKKPDEGEPQINRWLKEWGKYNCKLLKEKEKS
LIKECAVNKRKTDCSRKCNNECYTYRNFINRQKYEINKLGKNYVKVIRYNIFNRKIIPPN
NALDFIKLNCSECNDVNFKTLFEFEYGKYEEKCMCQSYIDLKIQFKNHGICLFNAQTDTV
SSDKRFCVEKKESKPWQCDKNSFEKVHAEGVCVSPRRQAFCLGNLSYLLSDDIYKVHNSQ
LLIEILMASKQEGKFLWKKHGITFYNNYACKYINDSYADYKDIVIGTDLWNDKNSIKAQN
NLNAIFERNFGYKVGRNKLFKTIKDLRTVWWILNRDNIWESMKCGISDVDPRGYSCVRMN
ELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKCKDTKGNSLCKEKTCQNVCTDMNYWTY
TRKLAYEIQSLKYNKERNLYSFSKDKNVSIFLKENTKNCYNIDFTKIFDQLDKLFKERCP
CMDTKRLEVKNKEMLSIEANSEEEEELQGNNNSVSVISGNEGTNSDTKVIVKDKNEKQQE
KEAKQTTGSLTVQTNEDSDSKKGKSTATDTKNSFEKLEVQKDATNGETIKEEHPELPQSP
ENSQTQEQEKSESDQPRTGQETGEQNEISSGQEQNEPSSSTEVVSQETTSENASPQDTEK
LSTEPKDNSVVVNKETSSNDLAHEMVDEEQD
Download sequence
Identical sequences A0A151LVZ9
XP_019970915.1.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]