SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151M476 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151M476
Domain Number 1 Region: 8-120
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000792
Further Details:      
 
Domain Number 2 Region: 217-298
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.79e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 298-356
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000248
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151M476
Sequence length 367
Comment (tr|A0A151M476|A0A151M476_ALLMI) Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:KYO19271.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0021967 OC=Alligator.
Sequence
MPHENQQVFELLGRKCLTLATSVAQLFLALPPGARGWAKQGCGVVCFVKDNPRRSYFIRL
YDLQGSQLLWEQELYAQMTYIAATAFFHTFPADECQAGLNFAHEGEADVFRALVDEKMKK
RQQRLDKRQLPALPPAIAEECRGSVSRPPGGTNGPGASPPAGGLGLATLDIANPDITAAR
YRGAPTPPSPILGPTSGGGARKGRKKISKADIGAPCGFKHVSHVGWDPNTGFDMNQLDPD
LRTLFSQAGISEDQLADAETSRLIYDFIEGQGGLAAVKEEMRRQGCAPGPQPPPPLKGRG
ALLDQIRQGVQLNKTPDVVESPLPAQSSEGLVGALMQVMQKRSKVIHSSDEDEDNGGDED
DDDEWDD
Download sequence
Identical sequences A0A151M476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]