SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151MVW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151MVW7
Domain Number 1 Region: 119-203
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-29
Family SCAN domain 0.00013
Further Details:      
 
Domain Number 2 Region: 714-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 784-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 676-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 614-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 416-463
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000123
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 587-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000011
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151MVW7
Sequence length 843
Comment (tr|A0A151MVW7|A0A151MVW7_ALLMI) Uncharacterized protein {ECO:0000313|EMBL:KYO28644.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0000810 OC=Alligator.
Sequence
MLQVTVHAKVKDVASDKMVPIGVLWEALDPWPEQPQPYPMDIPQEQTGWGETPGAQDELP
DVPHQLELGHSSARGSCTRVQEDAPKEKTWPAGPKHEQQETLAPAMVSPELALGDEVPTP
ETWRRRFRGLHYQAAAGPQEVCSRLQELCQRWLEPQRRSKEQMLELVVLEQFLAILPREM
QSWEWGHGVETCAEAVTLADGFQLGQAEDETLQVTVHMKVEDVALAKMAPTGTLWDPLDS
CLEQPQPHPVDMPQQEMGWGETPGPQDKLPHISKEEPPLQPESGPPETEKPWDTLADESS
WASCPRQDPSSGAANAAIPSKAEEQPYEEGPVIPELQRTSPEVLGERGSLTPELDQLQKG
QDRPLEVDLPRIPASPGHQEFAFPPCTPGSNSFARSLLVFMSSPVPEMASMAAAAQTQRR
LTFDDVAVYFTRKEWALLDDGDKALYRDQMLRNYQALVNLDSSGMEETDSSAEEGSEGSL
PCPEPSPDTAGAGTDSRAEEHPHQALSANVEPLRMFPETPTLPETARTEEKPNQCPECGK
RFSRIQSLVTHRMIHSGERPHHCAQCGKRFVTHSHLVRHQRVHMVAEPVYRCADCGKTFT
QPTYLARHRHRHLHAGVKPHKCAECGKAFAELYQLARHQFVHSEEKPHQCTQCGKTFTRA
SYLARHRHRHLHSGTKPHQCAECGKRFSSLESLIGHRKIHSGERPHSCADCGKSFIYPSD
LFWHQRVHTGERPHHCGDCERSFVYRSDLIRHQRVHTGERPYSCGECGKSFNCRSELLTH
QHVHTGERPHQCGACGRSFVYRSDLVRHQRLHTGERPHGCKECGKSFARLSHLTQHQLTH
MQK
Download sequence
Identical sequences A0A151MVW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]