SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151N3Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151N3Q1
Domain Number 1 Region: 359-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000127
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 231-353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 186-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000022
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 146-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 113-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000364
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151N3Q1
Sequence length 1612
Comment (tr|A0A151N3Q1|A0A151N3Q1_ALLMI) Uncharacterized protein {ECO:0000313|EMBL:KYO31410.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0006006 OC=Alligator.
Sequence
MELHMLAQLFVFTLQASLLIYGNKLQPLMPNVCTEQELAIVGHQQPCVQAFTRMVKVWKQ
GCAGRLWCLGYERRTTYYTSYRQVYTMKYQTVYRCCPGWSQLGEDAGCFYPAVCSYGVCF
NGGNCMEGSAQLCQCPSGFQGPRCQYDVNECEVENGGCESQCCNTIGSFYCKCSSGLKLK
DDGKACEDVDECQVHNGGCQHRCVNTLGSYYCECKPGFRLHTDGRTCIAVNTCAVNNGGC
EHNCLQLTLTQHRCQCRHNYELKEDGKHCILKSPCADRNGGCMHKCQNHRGMAHCECHPG
YRLAADNKACEDVNECATGLAMCAHSCLNTRGSFKCTCNPGYELGADGKQCYRIEMEIVN
SCEANNGGCSHLCRHTSSGPECTCNLGYQLDEDQKTCIDIDECESGSHCCQQDCSNSPGG
YECVCYAGYRLHTNGCGCDDVDECSSDNGGCEHTCQNQVGSFQCSCQIGYKLDEDRRSCI
SLGDSIEVLDGQRLIMYPLPHVAVLRDELTQLFEEDYEYEEEEMEARGEHTLSEKFVCLE
DTFGNDCSLTCDDCRNGGACNEERTGCDCPEGWSGILCNQTCPEGTFGRNCNFTCRCENG
GTCDPMTGTCRCPPGVSGELCEDGCPKGFFGKQCRKKCNCANRGRCHRIYGACLCDPGLY
GRYCHLACPKWAYGPGCSEECLCVQQNTQDCDKKDGTCRCKPGYHGKRCQTKCDAGYYGI
GCKNNCNCHLGVACDHVSGECQKECPAGFYGENCDQGCPEGKFGVNCLQSCSCGGSPCDQ
ATGKCRCLPGKTGHDCGRVCPDGHWGVGCQEICPECENSASCDPATGACLCPPGYRGSRC
QDMCPAGWFGQGCQMRCSCGNDGHCHPTTGKCSCAPGWTGYNCRRACDAGHWGLDCANTC
NCSNSDGSCNVVTGQCICEAGYMGPHCDQKCPEGWFGLNCRHRCQCDNGAMCDHVSGACT
CSPGWRGTFCEHACPDGFYGLECRETCPCLNGAHCDHVTGRCTCPAGWLGLSCNQTCQDN
RYGENCSQLCSCFNNASCDPMSGQCLCAAGWTGATCQQACPQGFYGVSCHQRCLCQNGGT
CDPVSGRCTCPEGWTGLACELECAQGQYGMDCRQSCECHNGGLCDRQTGHCFCQAGWTGA
KCESSCPRGTFGEHCEEECDCGDGASCHPVTGVCDCPRGWRGQHCERACLPGSFGKDCAG
HCNCPPGTPCNHITGQCGCPPGFTGHGCEQSCLPGTFGVNCAQVCHCPGANQDCDPITGE
CVCAPGYHGPRCQLRCSPGWYGSNCERQCQCKNGGHCATTTGACHCLAGYMGADCSISCP
AGRYGKNCAQLCSCGQGATCHPVTGTCICPAGRTGPRCEQACQKNRYGAGCKQTCTCQGR
AICHAADGSCLCGLGRTGMFCELECAPGMYGANCQLRCACQNNGTCDSVTGACRCTRGYY
GHLCEHSCPPGFHGLSCQELCDCHNGATCDPVTGRCLCPAGFYGTRCQTGCEAGKYGEGC
QRTCDCEGSVPCDPATGRCLCPPGKTGPKCDLDCRTNKYGPDCTMTCDCATFNSHCRAQN
GQCLCMNGYIGPTCREGGPPRLPAGQRSDAESGVPHRTSYHSLHGMLQRVHH
Download sequence
Identical sequences A0A151N3Q1
XP_014461279.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]