SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151N494 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151N494
Domain Number 1 Region: 358-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000118
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 230-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 185-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000272
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 145-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000206
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 112-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151N494
Sequence length 1611
Comment (tr|A0A151N494|A0A151N494_ALLMI) Uncharacterized protein {ECO:0000313|EMBL:KYO31409.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0006006 OC=Alligator.
Sequence
MELHMLAQLFVFTLQASLLIYGNKLQPLMPNVCTEQELAIVGHQQPCVQAFTRMVKVWKQ
GCAGRLWCLGYERRTTYYTSYRQVYTMKYQTVYRCCPGWSQLGEDAGCFYPVCSYGVCFN
GGNCMEGSAQLCQCPSGFQGPRCQYDVNECEVENGGCESQCCNTIGSFYCKCSSGLKLKD
DGKACEDVDECQVHNGGCQHRCVNTLGSYYCECKPGFRLHTDGRTCIAVNTCAVNNGGCE
HNCLQLTLTQHRCQCRHNYELKEDGKHCILKSPCADRNGGCMHKCQNHRGMAHCECHPGY
RLAADNKACEDVNECATGLAMCAHSCLNTRGSFKCTCNPGYELGADGKQCYRIEMEIVNS
CEANNGGCSHLCRHTSSGPECTCNLGYQLDEDQKTCIDIDECESGSHCCQQDCSNSPGGY
ECVCYAGYRLHTNGCGCDDVDECSSDNGGCEHTCQNQVGSFQCSCQIGYKLDEDRRSCIS
LGDSIEVLDGQRLIMYPLPHVAVLRDELTQLFEEDYEYEEEEMEARGEHTLSEKFVCLED
TFGNDCSLTCDDCRNGGACNEERTGCDCPEGWSGILCNQTCPEGTFGRNCNFTCRCENGG
TCDPMTGTCRCPPGVSGELCEDGCPKGFFGKQCRKKCNCANRGRCHRIYGACLCDPGLYG
RYCHLACPKWAYGPGCSEECLCVQQNTQDCDKKDGTCRCKPGYHGKRCQTKCDAGYYGIG
CKNNCNCHLGVACDHVSGECQKECPAGFYGENCDQGCPEGKFGVNCLQSCSCGGSPCDQA
TGKCRCLPGKTGHDCGRVCPDGHWGVGCQEICPECENSASCDPATGACLCPPGYRGSRCQ
DMCPAGWFGQGCQMRCSCGNDGHCHPTTGKCSCAPGWTGYNCRRACDAGHWGLDCANTCN
CSNSDGSCNVVTGQCICEAGYMGPHCDQKCPEGWFGLNCRHRCQCDNGAMCDHVSGACTC
SPGWRGTFCEHACPDGFYGLECRETCPCLNGAHCDHVTGRCTCPAGWLGLSCNQTCQDNR
YGENCSQLCSCFNNASCDPMSGQCLCAAGWTGATCQQACPQGFYGVSCHQRCLCQNGGTC
DPVSGRCTCPEGWTGLACELECAQGQYGMDCRQSCECHNGGLCDRQTGHCFCQAGWTGAK
CESSCPRGTFGEHCEEECDCGDGASCHPVTGVCDCPRGWRGQHCERACLPGSFGKDCAGH
CNCPPGTPCNHITGQCGCPPGFTGHGCEQSCLPGTFGVNCAQVCHCPGANQDCDPITGEC
VCAPGYHGPRCQLRCSPGWYGSNCERQCQCKNGGHCATTTGACHCLAGYMGADCSISCPA
GRYGKNCAQLCSCGQGATCHPVTGTCICPAGRTGPRCEQACQKNRYGAGCKQTCTCQGRA
ICHAADGSCLCGLGRTGMFCELECAPGMYGANCQLRCACQNNGTCDSVTGACRCTRGYYG
HLCEHSCPPGFHGLSCQELCDCHNGATCDPVTGRCLCPAGFYGTRCQTGCEAGKYGEGCQ
RTCDCEGSVPCDPATGRCLCPPGKTGPKCDLDCRTNKYGPDCTMTCDCATFNSHCRAQNG
QCLCMNGYIGPTCREGGPPRLPAGQRSDAESGVPHRTSYHSLHGMLQRVHH
Download sequence
Identical sequences A0A151N494
XP_019349527.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]