SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151NBR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151NBR3
Domain Number 1 Region: 371-495
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 243-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000345
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 200-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000522
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 158-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000787
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 125-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151NBR3
Sequence length 1597
Comment (tr|A0A151NBR3|A0A151NBR3_ALLMI) Multiple epidermal growth factor-like domains protein 6 isoform B {ECO:0000313|EMBL:KYO34069.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0024653 OC=Alligator.
Sequence
MWVALGRFNQLPYGTLFGVKLQRKEAEDSGSIGVKTAEDQSRPNVCPEQELAMVGYQQPC
VQAFTRMIKMWKQGCTGQRWCVSHERRTGYYTVYKQMYRMEHQTVYKCCPGWMQQDDEPG
CSRSLCTVGTCFNGGKCSEEGSQMCQCPEGFQGPRCQYDVNECTIENGGCYDQCCNTIGS
YYCKCPAGQKLGKDGKSCEDVDECVIVNGGCQQSCVNIQGSFFCECTMGYRLHADGRTCI
TVNSCTVNNGGCEQECIQITEDHYRCQCQPGYQLQRNGKHCEMIDPCAAGNGGCPHICQN
ERGFAKCECHPGHYLSADKRSCLDIDECVEGTARCAHRCVNTLGSFTCVCNPGFELGADG
KQCYRIEMEIVNSCESNNGGCSHRCEHSTGGPHCSCNQGYVLDLDGKTCIELDECETGEA
CCSQFCINYLGGYECTCKAGFQLNIDGCGCDDEDECVVDNGDCDQVCVNSLGSYECACEE
GYVLGINGQTCITLDNDELNKEEEEELEISRIPDLQFRRPPQLLKYAVTLDPFYEDEDVR
GELTLMQKVVCLDSTFGNDCSLSCEDCMNGGTCNSENSGCICLPGWTGMICNETCSPGTY
GKNCNSICKCQNGGSCDPVTGQCHCPLGISGKICEDGCPKGFFGKNCNKKCNCANNGYCH
RLYGACLCDPGLYGRFCHLTCPKWVFGAGCSEECQCVKENTLECNARNGTCTCKPGYQGS
RCQKECMPGFYGAGCKLKCNCSDVLCDHKTGECKHPCPPGFHGEKCHLSCNPGKFGVNCR
QSCSCGGASCDPETGRCLCPAGKTGSACGQDCPEGLWGVGCQFFCESCENGGQCNRETGI
CDCPLGYTGKSCSAPCPYGYYGQNCLLQCSCNINAQCHHVTGECTCPPGWTGYDCKRSCD
TGHWGQHCENACVCSNSDGSCDPVTGVCFCESGYTGKHCEQSCPNGTFGPGCKYSCQCKN
GAVCDHVSGACTCAAGWTGTFCEKACPDGFFGLDCHQVCECKNAASCNHIIGTCHCLPGW
VGAKCDQSCQGDSFGENCSHVCNCHNGALCDHVTGTCICRAGWRGATCQEACPPGLYGVN
CVQYCICHNRATCDRVSGACICPRGWTGIVCELECQEGKYGERCEQNCNCSNGGVCDRYS
GKCSCQPGWIGGQCDVVCPSGFFGEQCKERCDCKHSLSCHHQTGVCHCHKGWRGKQCDKP
CLSGYYGINCAQRCNCALGTPCHHVTGECGCPQGFTGYGCEKTCSPGTYGKNCNQVCQCS
AENEECHPVTGKCTCLPGYYGIHCDLRCPKGTYGPYCQKACKCLNGGLCDPMTGTCDCPP
GFIGANCSKSCPENRHGKDCSLWCSCGKGQCDPVTGKCYCPPGYIGPDCQQVCPQGRYGP
NCQRMCICKNGGICSHVDGSCTCGLGWTGSYCERECPPGRYGSDCHLHCSCQNNGTCDRF
TGCCQCPEGYYGHACEHTCPSGFFGLNCLHSCDCKNGASCNIVTGQCICPAGYQGIQCEK
GCKPGWFGDRCQYQCECGGVALCDPVTGKCLCPPGRTGDRCGSECKSGQYGPNCSLQCQC
ANKSQCNPQNGKCRCPSKWMGPTCEEGDPTKLPSYEG
Download sequence
Identical sequences A0A151NBR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]