SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151NYP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151NYP3
Domain Number 1 Region: 3483-3662
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.64e-25
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 3313-3477
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.22e-23
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 3091-3259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-18
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 2889-3085
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-16
Family Laminin G-like module 0.0096
Further Details:      
 
Domain Number 5 Region: 2690-2880
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000274
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 6 Region: 1400-1448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 7 Region: 1928-1982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 1881-1930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 9 Region: 1539-1587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 10 Region: 1490-1541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 267-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 12 Region: 509-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 645-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 326-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 15 Region: 1822-1861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000259
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 16 Region: 600-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 17 Region: 462-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 18 Region: 742-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 19 Region: 396-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 20 Region: 1982-2026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 21 Region: 2029-2078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 22 Region: 555-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 23 Region: 692-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 24 Region: 1782-1824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151NYP3
Sequence length 3663
Comment (tr|A0A151NYP3|A0A151NYP3_ALLMI) Uncharacterized protein {ECO:0000313|EMBL:KYO41992.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0002648 OC=Alligator.
Sequence
MKNRTRDSAIAFICGRKAPGSDDDDGLRTRIAATATCGEDGGALEDLYCKLVGGPVAGGD
PHHTIQGQYCDICSSANSNKAHPISNAIDGTERWWQSPPLSRGLEFNEVNVTLDLGQLFH
VAYVLIKFANSPRPDLWVLEHSTDFGLTYEPWQYFASSRRDCIEKFGPRTVERVTKDDDA
ICTTEYSRIVPLENGEIVVSLVNGRPGAMNFTYSPLLRNFTKATNIRLRFLRTNTLLGHL
MGKALRDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPNDPYRLQCDCQHNTCGGSC
DRCCPGFNQVPWKPATSDSANECQPCNCNGHAYDCYYDPEVDHHKASKSHEDMYEGGGVC
IDCQHHTTGINCERCISGYYKSPDHPIDSPYICYRCNCDSEFTDGTCEDLTGRCYCKPNY
TGERCDACAEGYIDFPHCYPVPAFSHNDTGEQVLPAGQIINCDCYAAGTEGNACRKDSRT
GVCVCKPNFQGAHCDQCAPGHYGPSCQPCQCSGPGQYEGTCDSETGQCLCRSGFEGQSCN
QCAPGYFSYPLCQLCGCSAVGTLPGGCDSVGRCFCKPEFDGPHCDRCSTGYHSYPHCHAC
SCDPRGSVDNTCSPAGQCRCHLNFAGHTCSQCAPGFYGYPSCTPCQCSAEGSLHGTCDQE
MGQCSCRPKVTGLRCDTCVPGAYGFPHCEVGSCNPAGLESTDPSLPLGSCACRAYVEGPA
CDRCKPLYWNLTPENPYGCTSCQCNTKGTISGVAECQQGSGQCFCKPNICGQLCSTCKDG
YFKLNRASYFGCQGCQCDVGGSVGPSCEKTGACHCRPNTRGPTCTQPAKDHYFPDLHHLK
LELEEGTTPDGRAVRFGYNPLEFENFSWRGYAQMSPIQNKVRVTVAVKEAELSLFHVILR
YINSGGATVYGKITAFQPRRRGTEQTKQIVFAPSTEPAFVTVPQNSFGEPFVLNPSVWSL
IVEAEGILLDYLVLLPSSYYEAPILQLKVTEACTYRPSPEQASRNCLLYKYLSADGFPSA
SGADAVCRIDNNLPRPCPVELITPSHPRMVLCSGSDVEVQVRLPIPQPGKYVVLVEYANT
DGQQTAGVAVTSPQQAPQQGTSTFYTCDYSFLCRGMVVDSENRLATFELRREATVRFTAD
RAHVFLHKVYLIPHRRFTMEFVEPKVHCISLHGTFSPNSSSCVPSRFPKLSQSIVLEGGQ
PVLIPLDLPLTHAFSVTPTGPTTGPPPRPPTAVDSSAELILLQPPQTAVVFNTRIQTLGR
YTFILHCYQPNHPTFPVEVLINGGRIWQGQANATFCPHGYGCRSLVVAENHIVLDVTDND
LSVIIRVPEDRQLWLDYILVVPEDSYSSQYLQEEPLDKSYDFISTCGVNGFYINPATSPR
FCKDSAISLSLFYNNGAQPCRCHEVGAVSRQCEPFGGQCTCKSNVIGRECSRCATGYWGF
PNCRPCDCGLRLCNEVTGQCICPPHTIKPECVVCEPQTFGCHPLVGCEDCNCSRPGVQEL
TEPGCDVDSGQCRCKPNVIGRRCNLCAPGYYHFPDCRSCNCHPAGTEASVCDPVTGQCHC
KENVEGPRCDQCRLGTFLLDADNPKGCTKCFCFGATDRCHSVEKYRVEFSDMNGWRLLSS
DRQEVGTSLRAEEDLVHADLKYLLEVYQELYWQAPSSYLGDRVSSYGGHLRYELHSDARR
GDVFVPMESRPDVILKGNQMSIMFREDTYPPPGDVHRGQLQLVEGNFRHTETHNPVSREE
LMMVLASLEQLQIRALFSQISSSIFLRRVILETVTDSAVGIRASNVELCLCPANYRGDSC
QECAPGYYRDTKGLFLGKCVPCHCNGHSDQCLPGSGICINCQHNTEGNRCERCKDGYVDS
YSPEGLLQCVGCPCPLSVASNNFAVGCIRKGSTMQCLCKTGYAGAMCERCAPGYYGNPLV
IGSFCQPCDCSGNTDPNMLFSDCDPLTGACSGCMHHTAGPRCELCAPGYHGDAVEAKNCT
LCSCSPCGTESCDPRTGRCLCKAGVTGQHCDRCQEGYYGYDSCSGCRRCDCDVGSLGASC
HTQTGQCSCQPGVNGARCHQCAPGYWGLGENGCTKCQCKGGSCDPRTGECTCPSGLTGKQ
CDTCIQQYEIPVASGPDSVRCEVCDTCVLLLLEDLRKIEASFPTIRNQLINLNASSIAWA
RLHGLKNTMETLANHLREHQRSMSGVRQRAEELVEENRDLTQDLNALQHKMTMTHRKANS
LDEHTKNTYQRVQQLLLNIRSIQNSIQELGHQMDMFGTGNVSATSTEEFRQKMAEVERML
KEMRERDFSSQRGLAENEEEEAQKLLHRVQNELHSKGEANRALVNNIRDRLTQYNSELMD
LRDALNEAVNKTRQTEDLNSMNLNNLEESQRKKKELQKQHGLVQDTLRMAEDSLAQVSDL
LQMIERAKEDYEKLAALLDGAKHPLTERVKKFSPASSKIPVVEAAEEHARFLDELARNLS
SIIRSTNQDGFIQRAIDASNAYASIIEAVKKAETAAADAADAASEALMGVVSGDLAAIAK
KLKRNSSALEEAVRQEQRKLSGPIKGTLQAAREKVTDLRARKDRLVTRLRAVQDMLEVDQ
DGTKEAIQNAKDAAAKANETAARVQDTLNSMKKNLDEWKDQYGDLRNEDLHQAVQDAKKS
VSSLESTIPLLLGKLSNLENRKNKNATVSENIVRIRQLITQARNAASKVKVPMKFNGQSG
VQVRSPSDLPDLAAYTSLKFYIQNPEPSSASAPARRQGGPDEGRFVLYLGSKEGTGDYMG
VVLKDRKVQWVYQLGDEEPTFLTIDEEIGEQFAVVSINRILQYGHMSVTMEKKTLHETKG
DSVAKGEQGLFNFDLHSVVFYVGGYPSSFMPPATLHYPGYQGCIELDTLNEEVVSLYNFH
HTFHLDTATEKPCARSKSTGDPWLTDGSYFDGTGYAEIKFESQIGPTKRFEQEMRMVSYN
GILFFLEHEGQFLCLAVQDGKLVLYYDFSDGLKVAESNNNLALLTVSSTTNKAVQIYLLK
MDNKKRILVRLERLTIFIVEQENSLENAVSYYLGGVPLSVLPESLKAIFPKGGSIRGCMK
GLKALGKYVDLKRMTTTGVSYGCTSDLLVARSVKLHGHGYLTLSLKNVPPLQDFYTGFSF
RTSQSDGLLYYHATAEGKCQVSLKSGQLALEVLRTALTTQNTYADDSSHYVAVYSDASGV
RLYVDDELQEATQAAEGASRQGLQEEQLRFQLGGLPETGALSNLTGCIGNVFVRRKSDPQ
MVVDLQQNVESFNVTMSCPRDQQPQQMQVSPKKDRRKPKGPSRPSRLALKGRRQSQEMTC
LLPRHPRAARGAFQFGGFSMSRLEFDDIPESFQEKSYFSMEVRLNATSGLLFYVASEQPG
SFMAVLVSNGRFVLLADLGGNKLRIQSKDKYHDRRWHTVFFSRDGRRAQLVIDGLKAQDA
TMATAGQFLXXXXLTWPRGAQLSWDTSVTSFSGCLRNLKLDQHPLPSPSRTFGVTRCYEG
ALESGVFFAAEGGHVTLANAVSLEQDISLKLEVRPRSAAGLIFHIGRTRSYLSLSMDDKK
VLLKANSGAGEFSTWVAHPALCDGQWHAITVTKQRNMIHVAVDRVGNNTVGPSQTHWAEH
KEPLHVGRMPETTKLGAASPSPLTPLPHYIGCIRNLMIDQHLIDLPGTATVRGSVGLRGC
PVL
Download sequence
Identical sequences A0A151NYP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]