SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A157SY24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A157SY24
Domain Number 1 Region: 13-156
Classification Level Classification E-value
Superfamily Nqo5-like 4.45e-41
Family Nqo5-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A157SY24
Sequence length 169
Comment (tr|A0A157SY24|A0A157SY24_SULSF) NADH dehydrogenase subunit C {ECO:0000313|EMBL:SAI83860.1} KW=Complete proteome OX=2287 OS=Sulfolobus solfataricus. GN=SSOP1_0306 OC=Sulfolobus.
Sequence
MGDEKMSEALKSLVNDLQTKFKCQAKIESDRRITVIVPDKKIIRDVASFLKDFGFDHVKA
VTGIDYPEHEKLEVVYHISSYSNLDLAKIILALRTTVSYKDPSLPSLYSIFESAWTGERE
TYEMLGIRFEGHPDLRRFFLDEDFEGVYPLRKSYKIKLEGVFVDKPTTE
Download sequence
Identical sequences A0A157SY24 Q980H4
355629 356342 SsT95 gi|15897263|ref|NP_341868.1| 273057.SSO0323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]