SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A157T398 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A157T398
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily OmpH-like 0.0109
Family OmpH-like 0.029
Further Details:      
 
Domain Number - Region: 326-355
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0636
Family Rubredoxin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A157T398
Sequence length 408
Comment (tr|A0A157T398|A0A157T398_SULSF) OrfB transposase, IS605 family {ECO:0000313|EMBL:SAI85341.1} KW=Complete proteome OX=2287 OS=Sulfolobus solfataricus. GN=SSOP1_1787 OC=Sulfolobus.
Sequence
MPTLGFRFRAYTDEQTLRALKAQLKLACEVYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDKYKQLYSQVVQQIADRYYEAKKRFFEGLARFPKEKKPHKYYSLVYPQYGWKILQ
VREIRKGSKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVIVKLTRSERIYITFVVDHEFP
KLPNTGKVVAIDVGVEKLLVTSDSEYFPNLRPLEKALWKVKHLHRELSRKKFLSNNWFKA
KVKLARAYEYLKNLRSNLYMKLGKWFAEHYDVVVMEGIHVKQLIGKSLRSLRRRLSDVAF
SELRDLIKYQLEKYGKKLILVNPAYTSKTCAKCGYVKEDLSLSDRVFVCPNCGWIADRDY
NASLNILRGSGSERSLVPVELRPLPVLWHGRAVKQEAPSLGGGSSPYR
Download sequence
Identical sequences A0A157T398 Q97XQ8
SsR52 273057.SSO1652 WP_010923548.1.43719 WP_010923548.1.8449 gi|15898470|ref|NP_343075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]