SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158NXN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158NXN6
Domain Number 1 Region: 27-264
Classification Level Classification E-value
Superfamily L domain-like 2.49e-45
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 262-358
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-19
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A158NXN6
Sequence length 638
Comment (tr|A0A158NXN6|A0A158NXN6_ATTCE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:XP_012062294.1} KW=Complete proteome; Reference proteome OX=12957 OS=Atta cephalotes (Leafcutter ant). GN=105625581 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
MGVSVFLLYAVTVLGVAASDNCADKCSCKWKSGKRTVECVNRDLTSIPEWIDPETQVLDM
SGNNICHLPNNIFIHVRLTNLQRLYLRECRIDRIDSEALAGLTNLVELDLSNNMLAAVPS
LSFTDTPFLRDLVLAYNPLKRIRSHAFKSTPNLVKLDLSHTQLVEIEAKGFRGLEMLESL
KLSNNELSTLHPGTFEPLNKLTSIELHENPWICDCHLREMKMWLVKHNLPTIVAPVCHGP
QQLLDRAFTDLGIDDFACRPILLIASRYAEATIGENASIVCRVSAIPPADVKWYWNGRLL
TNHSAFSSYQKILIFEEGQFRKRSTLILTNAQEADSSEFYCVAENPAGSVEANFTLHVSL
RTAGMSTLGSGQIAGISAALVVLILFILLIILVLFIRLRRMPLKDMKSSAPMEAASSDGN
GGNGGGGGGGGGDNNPSSATSTTRRKHEEIETTSFALESKPPASLHLSYVQRPHAAVMQE
SEYSTISRFDDQNQPAVAAMPGAGCFSSTTSLMPIDNPDLIRDTRRGSTEDITPYGVADY
GRVEALDDAGKMLYTSCLWEARDSCGRTSAVSANMYPSKEQLAVVAPVVEQFPPGAKQMR
VWQKGVPVLPPVSALKRVLGSTRSSPDEGYQEGTGTDV
Download sequence
Identical sequences A0A158NXN6
AC01838-PA XP_012062294.1.45171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]