SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158QSM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158QSM8
Domain Number 1 Region: 1021-1201
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-41
Family Patatin 0.036
Further Details:      
 
Domain Number 2 Region: 1213-1372
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.65e-19
Family Lysophospholipase 0.071
Further Details:      
 
Domain Number 3 Region: 52-188
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-16
Family cAMP-binding domain 0.025
Further Details:      
 
Domain Number 4 Region: 374-416,491-565
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000026
Family cAMP-binding domain 0.019
Further Details:      
 
Domain Number 5 Region: 624-720
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000498
Family cAMP-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A158QSM8
Sequence length 1743
Comment (tr|A0A158QSM8|A0A158QSM8_9CEST) Uncharacterized protein {ECO:0000313|WBParaSite:MCOS_0000109501-mRNA-1} KW=Complete proteome; Reference proteome OX=53468 OS=Mesocestoides corti. GN= OC=Cyclophyllidea; Mesocestoididae; Mesocestoides.
Sequence
LCCYRACNYRLFSGDPEGRNPLLKQRNLPESFFEPESENESEDMPEDLKLMVNHVRLLRY
LGRDVVQGLSSVISTIELRSGRFLFRDGDPEDKIFVVKSGRLDLRVIDEDGSTTTIHELT
TGGNPYSLLAIIDAMNNLQPKYQNIEAVAVSRCSVVCLSISDLIKVCRDFPPANLRLAQM
IIIRLHRVTFAALHNFFGLDKELFSQEPQTFLKESAVKSVLGRFGKSGRNAASNVPLPVH
DLSWYFLFKPSRKGAPSYPKWLFFVWVASSHKKRKSKPAILMPAGSSTADHLIPPQATTS
TGSLDEMGSLVPSNSVSKLLELGEVADGVSECSGRLSRTPSMRSTKLHDALVRAAQQDLA
RLFGISEGGQVLDKMVSVIDVNAGDVVIKETEIQPELYYIISGGFVLTQLNSVPGSVRFR
LFHICGDLGVRGRRVARGNFPDILNRHVKSQCLCPLKAFCKLRKLTKKQFRKLRKRETTQ
INHSPSLVAHQTSTKTVAVFEATPGELIGLLGVITGEPNNCSVQASADSRVAVLPRNDFF
SLVRAYPQVLTNAAHLVSLRLSPLLRQADFAIEWHGVDAGKALFNPSRLRDCTLFPILLP
VEAVAMRIRPLAVKMAMLFTVDICFRQGDCSNYVYVVLNGRFREVHTNDDGSRTVIAESG
RGAFLGYVEVTSCKPRVNTVLAIRDSEVVKMPSILLNWLKQLTPNPINRFIQLLSDRLMQ
PSSYSICSDGFNQPAVDLANSEPLNSTRCVLQKSQLNAAGSGGVMANLRAIAILATTPEI
NTEAFTLEMQHAMSVFGSSIRLTSGMQTRNCRGSCRLGRPPVVCARSASGTPAGKMGKLC
VWSRVDRVVGENFIFKCSRDIIKKRIGENAFEPLNDYRLCSWLSHQEDLHRMVFYIADSH
RSSAWTRRCLRQADCVVVLALGSTEDPSKLSPVEQVIDSCTTKVTKILVLMYPLETEYPP
AKKTASWLNARPWVTQHYHIRCPPRVLNPTVKNLITFYSQVFLVEEPNPHSDMSRLVRYL
TGQAVGLVLGGGGAKGGAHVGIIRVLQEAGIPIDMVGGTSIGALIGAMWAEETRVAEFSQ
RSRDFALVFKSIWPKIRDLTYPTVSLFSGYEFNAYIEATFKDRQIEDLWLPYFCVTTDIS
NCKMRVHTSGSLWRYVRSSMTYPLLLPPLCDPRDGHLLVDGVFVNVVPVSLFRLLSVSIL
PSVHPTPPHDPRTGSLWRYVRSSMSLSGYMPPLCDPVDGSYLLDGGYTNNVPADIMASFG
AKTIYAVDVGSVYDTNLTNYGDWLSGWWLIYQRFFRWWGPPIRVPNFTEIQSRLAYISCI
RQLEEVKSSGICHYLRPPIDRFMTLQFSAFEEIVAVGYNYGKEMLEEWQRSGAFNQMMPN
TYKRVRYRSSGGHRKARSVSIGALSTSTSSVLADDATHQDPTAADSHVAETAVKRRRGSL
EKMSPPPSTEADEGRHRPDFNDEWWKTWLRLHPERISKLALGSTAFDRMDDGKMLPLAEQ
WLYAPSKLHKSRKSTRRSKPRSRAPVLAKSVTPDSKRLVPTKGSPSDNEGDFSMDDEEGV
EAVDAADDFLVTASDPELSSIRYTMATTKLSHHHRSADKGASLTEVGLSDGEITPKVAVV
KAPHRRHRLRRRGSLNKVSCVGGSLVNRQTSHGADQLPVLLPVATPPPTHNQFPSLGEHL
HAKTVKQENGGSVASSAAHSVQHPPPSPTQSTVSSSTCTEEIPRCLTAPPSRRPCRSFFS
IVL
Download sequence
Identical sequences A0A158QSM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]