SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158RC96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158RC96
Domain Number 1 Region: 649-747
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.2e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 196-280
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00028
Further Details:      
 
Domain Number 3 Region: 1022-1094
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00072
Further Details:      
 
Domain Number 4 Region: 499-569
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 5 Region: 843-935
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000055
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 6 Region: 564-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 7 Region: 1102-1171
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000117
Family Eukaryotic type KH-domain (KH-domain type I) 0.00049
Further Details:      
 
Domain Number 8 Region: 282-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000789
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 9 Region: 1167-1248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.00038
Further Details:      
 
Domain Number 10 Region: 363-426
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 11 Region: 717-820
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000154
Family Eukaryotic type KH-domain (KH-domain type I) 0.00055
Further Details:      
 
Domain Number 12 Region: 410-493
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.00039
Further Details:      
 
Domain Number 13 Region: 931-1021
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158RC96
Sequence length 1311
Comment (tr|A0A158RC96|A0A158RC96_THECL) Uncharacterized protein {ECO:0000313|WBParaSite:TCLT_0000682601-mRNA-1} KW=Complete proteome; Reference proteome OX=103827 OS=Thelazia callipaeda (Oriental eyeworm) (Parasitic nematode). GN= OC=Spiruromorpha; Thelazioidea; Thelaziidae; Thelazia.
Sequence
MAKELMDKKVTELSLKTKPELAQRNTRADHRKTTSLNNTVELEPNMENIVICNQDKSIGQ
SDFASEGVLNLAPGAERQYALMQNGNAAGANGINHTETGVSVLDYSTDFPELPDKTNTCV
NQLLGGVWNKPPAVRSEKVTQVYHLSGDERMSRVSGKNFGNANEEQQKCNEIAIATGTEI
EICEAKDHSLTLLITGKRQQVEEARSRVARRLKTQATREISIPKEHHRVLIGKEGLKLRQ
LEQDTDCRIVVPNRDLASDVIKIIGPRDGIEKAIHEIQLVSDKQSKLAQEHLLIPRIYYP
FIRGPFNERINELASETGAKINIPPPLASSEVIVITGEKEGVHRAVAGVRQIYETMKAVV
KPVTCQVTRAQHRYIVGPQRRGLAEILKATGVSVEVPPEDEDSDTITLRGDPQKLGEALA
MVYAKASSVITAEITCEPWMHKFLIGAKGATLESLVPNKDKVQIGFEQDGLIYLEGAPEE
VKKAQVSLLNEINRLSEEMSSEIIKVHPSLHRHVIGRGGALSSIKDETGVQITIPNEQTN
SDEIKIEGRKEGVKKAIEDITEVVRRIENEKTRDIIIEQRFHKLLIGPKGEAIQKLREQF
PSVTFSFPEPGRKSDIVNLRGDKTEVDKAYKQLASLNKELLETNFQMAVPIFKEFHKHII
GKGGANIKKIREETQTRIDLPSGASNEDKIRVTGKKANVEKAVEQLTKIQNELASIVSVE
VNIPHKIHSRLLGSGRRLIQDIQDECGDVHIKFPPEKIISDKVSIRGSKDDVGRAEKMLL
ALAKDWELSSFEDCVSAKPEFCRFVIAKGGFHIKRIRDMCPDVRVLIPQTNIDLNDFTIR
FIGKKEDVAKVKEEMESMMEELNKTVEIEMDVDPKYHRYFVIRNAAVLREIQDQNGGVLI
FFPRAGTNDSKVTLKGGKQYVEGAKDRIEKIVQELASRVVLKIEIPEEHHRALLSNRGQK
IQELQTTYNVQIRFPDRRLRENLQNESNKNVQGEPSPLDIITISGLEVSCEKAAEALKAL
VPVTKKVNVAFEYHRFLIGRSGETIRSLMQAHDVNITIPPEDTHLNEILVTGTNENVESA
VAEILRRVREFEEAAEDRRLRSFKLTFDIPSEYHVRLIGPRGKVVNELRLKHDVSIAFPR
NSDMPDTITLTGYEANCIACKQEMEAMVGEVQSLFSQQIFLDAAFHPRLIGQKGRNLKKV
MDTFRVEIRLPRSNDPDPNLVVVAGKNEDAVYDCIEQLRREEEEFLQERLERNQYFSLRA
AEQPPPPPRIEVEIKGAPWQLDMQSEEQFPTMGTTQGTAAAGGVWSGVRRF
Download sequence
Identical sequences A0A158RC96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]