SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A161RH50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A161RH50
Domain Number 1 Region: 40-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000314
Family SMI1/KNR4-like 0.0093
Further Details:      
 
Domain Number 2 Region: 181-245
Classification Level Classification E-value
Superfamily ClpS-like 0.0000401
Family Ribosomal protein L7/12, C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A161RH50
Sequence length 256
Comment (tr|A0A161RH50|A0A161RH50_BREPA) Uncharacterized protein {ECO:0000313|EMBL:KZE39412.1} KW=Complete proteome; Reference proteome OX=54914 OS=Brevibacillus parabrevis. GN=AV540_03940 OC=Brevibacillus.
Sequence
MEPVYSQIDAILSQMRSFVQAMCEQDPDFYAKYPMQLLAEADEQAIKSVTATWTLPEEYV
YFLQHYVPQCVSWSTDDYINLDIYGANDLLDGQLGYNYNPVTDEVIEDWPKSFLVIATDE
GDPYCIDLSRGDTVIYTAEHGMGVWDFAVAYDNLAEFLRSALRPRSITETDVEELEDFIY
NKVMITGAGADKLKTLLFIKKWFKCDYGQAKAHLEAAPLLVFKGLESVAAKVANELASIG
AKYEVSEISFTEFVQR
Download sequence
Identical sequences A0A161RH50
WP_063231709.1.56342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]