SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165F9T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165F9T7
Domain Number 1 Region: 27-164
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000137
Family DJ-1/PfpI 0.031
Further Details:      
 
Domain Number 2 Region: 542-580
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000034
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165F9T7
Sequence length 597
Comment (tr|A0A165F9T7|A0A165F9T7_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KZT56444.1} KW=Complete proteome; Reference proteome OX=1353952 OS=Calocera cornea HHB12733. GN=CALCODRAFT_555897 OC=Dacrymycetes; Dacrymycetales; Dacrymycetaceae; Calocera.
Sequence
MAASDATTVYCLVFDHCGFPVRPVNYVYFFDVLGPKYAIKTVSVQATKTIKDTKFQNRFA
PSAREAVEYEADLLLADLQDLAEINIICIPGGELGAPRLASSQSLGVALRPIIDKARWII
TEGLGSTVLAAAGLLDGRRALVTLAGLAGAKQDYPTVDWGTDRFFRPMGKILHEQKFIMS
DNLGRPAPAYESAAARLNANFFKSVVERGENLIEAIPPPPTLSRGAEGPQYTAITDAQVA
DLTNSIKTEREDPQLIRIAEDFAIRLASEGYVEDCNVIVTELLNHQSDALNPLIKRGLEM
IWHTAGPRPETPYPQPTDAELASMEEEQRYHDLRERSMVSISNFSEVPFAQLAPDQVGVL
ATAFAAVQHREKRKLIKRVELGGGASATSYDEGPISMPTEDEERRGLGAFRNYMSRRDED
DSPLNIKLLIVYSNLALKYGLEEEGKRWLELCLQEALKTTSSWLTLASLANGRYTSVELG
KGALQRLTGTTQAVAHRAAQEIAAALRDRWQAGEQRPFASLSWPELLQRIQDGQVETREA
HDGRYLRQPAPEQAIAAAEARLGVTLPSDYKAFLRTTSAVFNAAPEHSEGLRSTGAT
Download sequence
Identical sequences A0A165F9T7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]