SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165RFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165RFX3
Domain Number 1 Region: 469-511,548-586
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000018
Family UBX domain 0.05
Further Details:      
 
Domain Number 2 Region: 229-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000085
Family Thioltransferase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A165RFX3
Sequence length 621
Comment (tr|A0A165RFX3|A0A165RFX3_9APHY) Uncharacterized protein {ECO:0000313|EMBL:KZT70698.1} KW=Complete proteome; Reference proteome OX=1314783 OS=Daedalea quercina L-15889. GN=DAEQUDRAFT_688992 OC=Agaricomycetes; Polyporales; Daedalea.
Sequence
MDVDALSPTQKEALAQLQAVMDGGDADVAISVLESVDWDIQRAANLIFENGIPPTKPRSP
SPPTQIEEFEIDDSSQGLLGNPRGGREFRRVRPSSSPGARPLRAVLAVLTLPLRLLTSVL
RFVFRLLRIPFPQFAPFTWSSLQYRPLGPGAGADARALDPRAQAERWVRALEEETGAVCV
GRARARRAETKVGNASMASGADVAGPSGLTSRAGTYGEEDAGEGVTKFLPDFFLGSYEEF
VRMCERNAKIGCVVLVSEEHDDVPEFKRYVNTLTDPTLLKLIQDNDITVWGGDIRDREAW
SAAQKLQATTYPFIAFMALQQRRVVGSGSSASPTLTVLSRHQGPSIPSTSAPTAAQTLIT
HLTEQLFPRVTPFLAKVRSQAAEREHERQLRAEQDRAFEESRRKDKERIEARQQEEQRAQ
QEERRRAEAETRAREEARAQEVARRAWEAHRMEWRKYLRRGLVMREPRPGETGRGKTMRI
GLRMPDGRRAVRFFGESDTLSALYAYVDSMFVPKEVPEKADPQTPPADGAPGEAGLIKEI
EGSDRAPEKWWGFKLWLAYPRKEVVWEAAKRLGDVEVLRGGGQLVVELTADTESAKGKGK
QRATDAAAAVEEEDDGYETEE
Download sequence
Identical sequences A0A165RFX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]