SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165SSE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165SSE6
Domain Number 1 Region: 192-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000939
Family Thioltransferase 0.09
Further Details:      
 
Domain Number 2 Region: 377-462,492-525
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000121
Family UBX domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A165SSE6
Sequence length 553
Comment (tr|A0A165SSE6|A0A165SSE6_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KZT25606.1} KW=Complete proteome; Reference proteome OX=1314782 OS=Neolentinus lepideus HHB14362 ss-1. GN=NEOLEDRAFT_1092611 OC=Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Neolentinus.
Sequence
MDNLDPGQRAAVAQLQSITDGNYDADTVVSILESVDWEIEKAANVLFGDQETSSFVRGSS
TSSSTGSNDTNHIVSGSRRNPQSSPNITATISYYLRPSMLLSILTFPFHFLSGILRTIFL
VLRLPFGPSTTRFSSLTFLRRPPKSTDPKAAADRWVRALEEETGATCVSRAGLLGAALED
LEAAAEDGKKVLPDFVVGSYEEALRKCEKEVRVGCVVLVSEEHDDVAEFKRATLTHPKLV
HLMHSNNFVVWGGDVRDPDAWSASQKLQVTTFPFIAFLALQPRRTSSTSSSNRSDTPTLT
VLSRHQGITPTSPSNLVKHLEDQLLPRVNPFLARTRQTRLRAERDRQLREEQDRAFQEAA
RRDSERLREKMEKEEREKEEMMRREEARERESVRREGVERVKRRMRTWARETVVPMDAKQ
REAVRIAVRSPSGGRLVLALDPRTSLTQLYAYVDAALLSPGSASEEGGNFGEKNVLEEIQ
MLGGHADKWWEFKLALTFPRRELEWMPDRCLAEIDGLKGGAQLVVEMCQKEGDTVNEKGE
EEDGYETESDDET
Download sequence
Identical sequences A0A165SSE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]