SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165XJU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A165XJU5
Domain Number - Region: 105-124,163-181,219-315
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00379
Family Pseudo ankyrin repeat 0.05
Further Details:      
 
Domain Number - Region: 437-565
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.0118
Family Class I alpha-1;2-mannosidase, catalytic domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A165XJU5
Sequence length 631
Comment (tr|A0A165XJU5|A0A165XJU5_MIMIV) Putative ankyrin repeat protein {ECO:0000313|EMBL:AMZ03210.1} OX=1835008 OS=Mimivirus Bombay. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MSQTFFLISDPDNLDYPIYTVHDKSRILDCFCDISLFKTTTITEIELDNEHPDFKILKLY
GNTFMTNRIIKNTKYSLLDVNTVQMLLDYGDPDYEFKSTHYLYVFYMSQNRFDICDYLIA
SNIKFVGTYTKSCLLNQNTLTNYHLFKYIINNSEFFGCCHYDLMYAAFRYTKFYDLCDHL
IKSEYNCNIDYDNFLRQLFNKTDSNGFTINCELDTFQIKKLIDENYFDNEKLFYTVLYDS
FELTKYIVEKGFYYDFDSVINSDINLEMLKFFIELGNNLTDDHIMILLSKKYSNDYCKKI
TFLLDNNYITEKHFTNKIVSDIVWFDLNLLDYLINKLNIIELINLDILMKTSILRENINM
IKKCIEYGINVDDYMKFAVDYSICITKKLIELGGNIPDDICIYNPYHSLSIESIDIILEN
NYDSLENLLLKIINQNKETLYIDEILHIMGKLISTNKPIPDLNKILIKSCYYSDNIYKEI
IKLDLNLDNYQQIFVNIMRKEYDNIEQLIFFSTYYNSIELLFVVVLSENIDLFKLLLEIN
CNDTDYLSWAFVFSGRCFKLMKYIVDNYNVDIYQRQIEVCIMIPKKDYQTKRYLQLMGYE
ISCIYNTECNNDKLPLVEFMKELSIDSTIRP
Download sequence
Identical sequences A0A165XJU5 A0A1E1EUH8 J3E752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]