SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A166I3L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A166I3L8
Domain Number 1 Region: 274-609
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 5.49e-50
Family Patatin 0.0000351
Further Details:      
 
Domain Number 2 Region: 9-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-26
Family Laminin G-like module 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A166I3L8
Sequence length 620
Comment (tr|A0A166I3L8|A0A166I3L8_NODSP) Patatin {ECO:0000313|EMBL:KZL47824.1} KW=Complete proteome OX=1819295 OS=Nodularia spumigena CENA596. GN=A2T98_21225 OC=Bacteria; Cyanobacteria; Nostocales; Aphanizomenonaceae; Nodularia.
Sequence
MVKKVIEQSVLTFDGQHDYIDFGKNDPDLVLSQGTSGFTVSGWVNPHHLTRQATTYGTRN
VFFARSSDRYSDNFEVGVSPTGNLDIYIDEQLSKFIKTLGNGELTIGEWHFFAIVFNQGD
LTVYLDHNQYIEYFTGSALNKATSPITLGGTLHNNIHFSGQLAHISVWNYPCNQEQIQAH
RSGLIVGDEEGLVAYWKLDEGEGTIVNNQTGNFYQGNLYGNPIWNLTQITFLGESSAEEE
TKTKQPEAIFNIQASPTLSQEKLAEDINQTEQQKYKILAIDGGGIRGMIPALLLAEIEKR
TQKPIFSLFDLIAGTSTGGILALGLTKPRLNQETSDKLAEAEYTAADLSELFIEYGVEIF
YEPLFEKLLGPLEDIFLQPKYASTSRVEILKQYFGDSLIENNLKEVFVTSYDIEQRIPIF
FSNKLEKQQIKSKKFRNLCAGFSLLDAALATSATPTYFPPHRIVTSHNTNGFYTLVDGGV
FANNPSQLAISEAKSSKQEANRILNTEDILIVSLGTGSLTSVYPYDEVKNWGLLQWGRPL
LNIMFDGSSEVVAGELERLFAFSNRETKSSYYRFQTFLDAELEEIDKTTLRNTRQLQAAA
KQMIAQNSKKIDELCSLLLE
Download sequence
Identical sequences A0A166I3L8 A0ZMY2
WP_006199155.1.65595 WP_006199155.1.7687 WP_006199155.1.86392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]