SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A166UW65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A166UW65
Domain Number 1 Region: 224-381
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-22
Family Glutathione peroxidase-like 0.0031
Further Details:      
 
Domain Number 2 Region: 95-183
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000233
Family FAD-linked reductases, N-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 4-100
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000141
Family PHBH-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A166UW65
Sequence length 382
Comment (tr|A0A166UW65|A0A166UW65_9PEZI) Pentachlorophenol 4-monooxygenase {ECO:0000313|EMBL:KZL73883.1} KW=Complete proteome; Reference proteome OX=708197 OS=Colletotrichum tofieldiae. GN=CT0861_08422 OC=Colletotrichum.
Sequence
MLQESTQHEWVRIDGKMETDMPDANLGSSSIETAKHGNVLWVKLDKDAYRIGYALTPELR
AKYPQGLTQEQAVEEAIESLKPFNLAIPRVDWWTSYSVIQGVAATMQKDNFVLLAGDAAH
VHSSGFAQGMNTGVHDATNLIWKLAGTIKGWYNPFVLTSYDSERRPIAHKLIEMDKLASD
AISGNIPIRYRELVAKEANADDIVTKIYSENVAFVSGLGISYALSLINHEPLSGTVMAGH
RAPDAVLKQPGRRITIRLFDVTRAYGRWSILVFGGYHTVTQSKLITLRDQLLADKTGLAT
RYFSVLKLSTIIAGSTSSAWEVFDGPGMGKLYFDPEGAAHCLYGVSLNSGAVVVIRPDGI
MGFATALNESDKLEEYFKGFCL
Download sequence
Identical sequences A0A166UW65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]