SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167RN59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167RN59
Domain Number 1 Region: 13-149,206-265
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000209
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A167RN59
Sequence length 481
Comment (tr|A0A167RN59|A0A167RN59_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:ANB50905.1} OX=1842663 OS=Powai lake megavirus. GN= OC=unclassified Mimiviridae.
Sequence
MFFTINNNSLKSSNNDGTNNTYIKIFNIQDIEQMYNLGTTLYIIKTNGQHNVNAYNKTMC
TNQFEIISKYSLYDISTYEYFGLDITKNIYIVDFACKEGNIDFLNWWLSSGYDLKYTQAG
MDNANRFKEIEILNWWVNSGLEIRYTYKSMDRASNLAVFDILNWWITSGLPLKYSESSMN
LDYFASLSEEDEIHVLTWWKESGLLLKYNHSAIDNASRKMHINVLNWWIESGLDICYSEN
SIDCITISNNTKILDWWLESGLKIKYTELAIDIASRYFSLDVLDWWLKSGLEFKYTSDSL
DDINLHFFTNINQEEDEYEIIKLLDWWKSSGLELRYTNSCLDAMSEYGYIKVLDWFKNSG
LPILYSTEAIDCTDDINVLEWWIKSDLPPKYSCKAMNICTNIEILQWWINSGLTIKYDEH
LIDGAFTNDRIDILEFMLSSGLPFIHSKYCVLGYMNKIPVLSIQWWINHELPKEYISNIN
Q
Download sequence
Identical sequences A0A167RN59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]