SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167VJB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167VJB5
Domain Number 1 Region: 40-90,124-231
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.15e-26
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00028
Further Details:      
 
Domain Number 2 Region: 455-466,516-626
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000353
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A167VJB5
Sequence length 719
Comment (tr|A0A167VJB5|A0A167VJB5_9PEZI) Flavoprotein {ECO:0000313|EMBL:OAA62686.1} KW=Complete proteome; Reference proteome OX=1081102 OS=Sporothrix insectorum RCEF 264. GN=SPI_04226 OC=Sporothrix.
Sequence
MNSSSLRSDDQPPPAFVHFLPKTPSSASFDFDAMPREPQLNLLVAANGPKEVAYAQAIAV
RLSKEPKIAIKVIVDDLTHRLTQEFPAYANRCLRSYVSFSGGFGGGGGVSTGGSSSSNTG
GPASYNSVSPDDVEYAQRRAFELVAWADLLVLAPLDADHLARMMAGLADTLLLAVLRSWD
ASKRILLVPGMSTHMWENPVTKRQISKLHRKWHWIRVLPPILWHYADQHHYYHTVGSSGS
YGGYSHYGHTSSSPSPVGSQLQLHQQSTTSLSSSQPQQRKRVVEWTGFADLISIIKNHAD
LQSLGHDVDVAVLSGNANNSSNPPKRVETRLPPELWTIILEYTGDWELAEALGVFTHLPM
PTNQGWRRQPRDPSDPQQVFMHELEWTLLTARTDRICQTLARAPVAAVAAATATTAASDA
AANTAVTTNMAAAAKTAPPTPPAPLHDLSALAIKLIFKFALTDVLAYIEAYCPLVFRHFD
GKTVPTKASAYFGRTEILDWWLRSPSFLEKQYDAEALDGASKNGYVHVLEWWRRSGLPLR
YTEAALEQASARGHVHVLAWWREASLANPGLMLKPGRSLLCAAQHGRVAVLRWWEEESGL
NAGHQDAVCRVASRWGQVAVLELWRELRGDDQITFNHQVLVEPTMYSHVDVLAWWRDYAH
GRLPHMDGRRAKQVEYRAMDIEEALEDALGDQTAVRRWWAENGLNLGLGTSEWMKPRYL
Download sequence
Identical sequences A0A167VJB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]