SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168DWC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168DWC1
Domain Number 1 Region: 12-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000562
Family SMI1/KNR4-like 0.014
Further Details:      
 
Domain Number 2 Region: 182-246
Classification Level Classification E-value
Superfamily ClpS-like 0.00000488
Family Ribosomal protein L7/12, C-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A168DWC1
Sequence length 255
Comment (tr|A0A168DWC1|A0A168DWC1_PAEMC) Uncharacterized protein {ECO:0000313|EMBL:OAB34575.1} KW=Complete proteome OX=1468 OS=Paenibacillus macquariensis (Bacillus macquariensis). GN=PMSM_11985 OC=Paenibacillus.
Sequence
MENYDKEVDAFIEKMQAALEEMRGQDPEFYTKYPVSLITEAEEQAIRIVSDKWRLPDEYL
YFLKHYIPESVAWSTDEYINLTIYGAKDMLKGQWGYNYNPVTNEAISDWPNNYLVIATDE
GDPYCIDLSRGDTVIYTAEHGTGTWDFFIAYDNLVEFLHSVLLPPRSSGEWDTGEEVQYK
YYKVFIIGEGSDKIKTLMFIKKTFSCDYSQAKSYLEAAPLLVYKGIDLGAEKTEAQLKSI
GADYEMHKISLEEFL
Download sequence
Identical sequences A0A168DWC1 A0A1N6VXA8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]