SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A170YJ98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A170YJ98
Domain Number 1 Region: 59-116
Classification Level Classification E-value
Superfamily RING/U-box 6.12e-21
Family ZZ domain 0.0097
Further Details:      
 
Domain Number 2 Region: 6-45
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000981
Family PB1 domain 0.016
Further Details:      
 
Domain Number 3 Region: 255-286
Classification Level Classification E-value
Superfamily UBA-like 0.0000459
Family UBA domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A170YJ98
Sequence length 286
Comment (tr|A0A170YJ98|A0A170YJ98_TRIIF) Sequestosome-1 {ECO:0000313|EMBL:JAR99969.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
PSLREHPFIISWKDREGDQVQIWSDEELIIALTEMEDECKKLYVIPGQTPYHPLNPSDSQ
NSKIVHYGVTCDGCEKEVIGFRYKCAFCPDYDLCQDCESKKIHSHHYMVRIPVPIGKDVE
FGRKMMREFFKFNRHASKPDRECKRGGGYNKRVVTCYSPFTQPPQCTSNSGAQGEPSASP
HSRSFLEQGLPINVEGIIESVKPSGSEQNQVPNGAQSNLKAGGDMHHQSVFQPPQLQPHM
NLFTPVSQPNSNPNQAKIEESLNRMLSMGFNNEGDFLRQILISKNG
Download sequence
Identical sequences A0A170YJ98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]