SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZM9
Domain Number 1 Region: 32-481
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-157
Family Cellulases catalytic domain 0.00000000000943
Further Details:      
 
Domain Number 2 Region: 489-644
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.6e-36
Family Cellulose-binding domain family III 0.0000176
Further Details:      
 
Domain Number 3 Region: 651-715
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000157
Family Type I dockerin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173MZM9
Sequence length 716
Comment (tr|A0A173MZM9|A0A173MZM9_CLOCL) Endoglucanase {ECO:0000313|EMBL:BAV13037.1} OX=1493 OS=Clostridium cellulovorans. GN=Eng9B OC=Clostridium.
Sequence
MKKLGSILASVVMLASITAPLKAPVKVSATENYNYGEALQKGIMFYEFQRSGDLPENGRN
NWRGDSGLTDGKDNGLDLTGGWYDAGDHVKFNLPMAYTVSMLSWSVYESRGAYEKSGQLP
YILDNIKWATDYLIKCHPSPNEYYYQVGDAAADHSWWGSAEVMPMARPSFKVDTANPGSA
VVGQTAAALAAASIIFKDTDPSYSELCLKHAKELFTFADTTRSDAGYKAAQGCYSSWSGF
YDELTWAATWLNMATGDSAYLDKAESYVPNWGVELGTSTPKYTWAHNWDNCIFGSYLLLA
RLTNKPLYKECAERNLDWWSTGVGTQRVPYSAKGLAVLDMWGSLRYATTQAFLASVYADW
SGCDVTKATAYENFAKSQIDYALGSTGRSFVVGFGENSPTHPHHRTAHSTWMGYLTCNIP
DYSRHTLYGALVGGPDTSDKYTDDINNYQNNEVACDYNAGFVGILAKMYDKYGGTPIENF
KAIETPVDEYLAYGSSSGTSGNELQLMVSIRNQTGWPARGSDKLSARYFMDITEEIKAGI
KPSDFTAKASTSGVKLSGLIPWDVDKNIYYINIDFTGTNISPINNNTYKKDVYMSIGIPY
GTAINCANDFSFQGLTATTGGQDGVKTKYIPIYDNGVKVAGEEPTLIVNPTIKKGDVNND
TKISAMDLALLKKHIMGTSTLTGDAFTAADVDSNGKVNSIDLALLKKYILGQITSF
Download sequence
Identical sequences A0A173MZM9 D9SRK9
gi|302875569|ref|YP_003844202.1| WP_010076628.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]