SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZN3
Domain Number 1 Region: 62-101,181-315,344-416
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.54e-16
Family beta-glycanases 0.04
Further Details:      
 
Domain Number 2 Region: 549-613
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000458
Family Type I dockerin domain 0.00076
Further Details:      
 
Domain Number 3 Region: 446-542
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000036
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173MZN3
Sequence length 617
Comment (tr|A0A173MZN3|A0A173MZN3_CLOCL) Endoglucanase {ECO:0000313|EMBL:BAV13029.1} OX=1493 OS=Clostridium cellulovorans. GN=Eng9A OC=Clostridium.
Sequence
MRNEKKIRKKGIFTVGSTMVIASMLPNAVVLAGTTGSINVNIDTTAERAAISPYIYGGNW
EFNNANLSAKRLGGNRFTGYNWENNFSSAGSDWKQSSDTYLLSNGNIPEARWSEPGVVAT
DFHDKNLSAGESYSIVSLQAAGYVVADGNGTVAESEAAPSARWKEVKFKKNAPFSLTPDT
TDNYVYMDEYVNFLVNKYGNASTATGIKGYSLDNEPALWPGTHPRIHPQQPTCAEIVDKN
INLAKAVKSVDPYAETYGLVAYGFAEYNNFQSAKDWDSVKGSYNWFLDYYLDSMKKASDA
EGKRLIDDLDLHWYPEASGGGKRICFNDDTNCTNIDCNKARLQAPRTLWDPTYTEDSWIG
QWCKDKLPLIPKVQNSIQKYNPGTKLSFTEYSYGGDNHITGGIAEADVLGVFGKYGVYFG
SVWGGGTYTASGFNIYRNYDGKGSKYGDTKVKAETSDVENSSVYASVDKNDDSKLHIIMI
NKNYDNPETINVNLSSTKNYKSGKVWTFDQTSANITEKAPIESISGNVFSYTLPALSVAH
IVLDTNSSTIMYGDYNKDAKVNALDYGLFKKYLLNSDGKYEVVLDLNLDGKVNAIDFAIM
KQYLLGIIDKLPSTPSK
Download sequence
Identical sequences A0A173MZN3 D9SWN8
WP_010073657.1.47838 gi|302876451|ref|YP_003845084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]