SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZN4
Domain Number 1 Region: 42-318
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.82e-47
Family beta-glycanases 0.0000161
Further Details:      
 
Domain Number 2 Region: 347-478
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.88e-31
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.064
Further Details:      
 
Domain Number 3 Region: 483-577
Classification Level Classification E-value
Superfamily E set domains 1.26e-21
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.0062
Further Details:      
 
Domain Number 4 Region: 582-650
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.23e-16
Family Type I dockerin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173MZN4
Sequence length 652
Comment (tr|A0A173MZN4|A0A173MZN4_CLOCL) Endoglucanase {ECO:0000313|EMBL:BAV13034.1} OX=1493 OS=Clostridium cellulovorans. GN=Eng5D OC=Clostridium.
Sequence
MNKYCLKVMKCLFVSVFAMLLFTLIPTNQVFAAVDETHPGYRVEGRFLYDNTGEKVILYG
LNKMVIWLDKDGDPSFKEIAKTGANSVRIVWTMDGTAAELDTAISNCRAEHMIPIVELHD
ATGEMSKLPSLINYWIKPEVVNVIKKHQEYLLVNIGNEVGNGNVTEADFKINYETSVKQM
RAAGIHVPLIIDAPTWGQNINVLQACGPYLTSVDPDKNLMYSVHMWWPYMYGHTDQEVVN
EIAESVNMNLPLIVGEFGNQWEATESGKIPYKLIMEQCYKNQVGYLAWEWGPGNNPQTFL
DMTTDGTFATLRDWGLEVAITDTYSVKNIAKRPASILGNLLPELPKEPLPAGNLAAGKTA
TASSAESTTYSASNVTDGDFGTRWASSASDPNWVYIDLGEKKEINRVIIKWEAAYATQYK
IQVSDDANTWTDIYTSYSGKGQTEDISLTGSGRYVRVYGMARYNYSWPYSIFEIGIYGPE
SAQSASISPTVAVFDKNIEKQADLTITLSPQSNTLAAIKNGTATLVAGTDYIVSGNTLVI
KKSYLASQATGTIKLTLDYNNGVDPIFTVAIGDTTPVGGPTPTIIYGDVNGDKVVNAIDF
ALLKKYLLGLSTLSEDTLKKVDLNQDSKVNAIDLAIFKQYILGTVTSLPVVK
Download sequence
Identical sequences A0A173MZN4 D9SQV3
WP_010075571.1.47838 gi|302875440|ref|YP_003844073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]