SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZN5
Domain Number 1 Region: 13-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-67
Family beta-glycanases 0.00000153
Further Details:      
 
Domain Number 2 Region: 396-462
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.02e-19
Family Type I dockerin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173MZN5
Sequence length 463
Comment (tr|A0A173MZN5|A0A173MZN5_CLOCL) Endoglucanase {ECO:0000313|EMBL:BAV13031.1} OX=1493 OS=Clostridium cellulovorans. GN=Eng5B OC=Clostridium.
Sequence
MKKIKKNAARFAASIMTAGLAMSYSTAITKAETTTIDKYNVRNITTGQVVQNMGLGWNLG
NTFDAFGTWINGTKVSDYETAWGAPITTKAMIDGVRKAGFSSMRLPVAWSNLMASDYTIN
AGLLDRVEEVANYALDNNMYVIINIHYDGGWFSGFSTDYDTNIKKYTSVWTQITSRFAKY
GDHLIFESLNEEGCFNDIWNRWGGTTGKDKAFGILNNINQKFVDIVRASGGNNAKRHLLI
AGYATDIDLTCDPYYKMPTDPANRCAVSVHYYNPSPFAVLDADADWAKAQTTWGTASDLA
DLANYMNKMKTTFSDKGIPVIVGEYGVAQKNKTPEMVRLFLTSVAKEAYKNGLCPMLWDG
PGPQNVVYNRTTCQMNDSELAAQYKAIPQTVTRVNQINYGDINKDKNVNALDLALMKKYL
MAPNTTSDTKVMDVNGDGAVNAIDLAYLKKYLLGQITVFPVQA
Download sequence
Identical sequences A0A173MZN5 D9SW41
gi|302874316|ref|YP_003842949.1| WP_010075948.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]