SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZQ1
Domain Number 1 Region: 206-385
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.54e-23
Family TAP-like 0.044
Further Details:      
 
Domain Number 2 Region: 391-451
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000137
Family Type I dockerin domain 0.001
Further Details:      
 
Weak hits

Sequence:  A0A173MZQ1
Domain Number - Region: 64-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000689
Family Fucose binding lectin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173MZQ1
Sequence length 453
Comment (tr|A0A173MZQ1|A0A173MZQ1_CLOCL) Lipase and esterase {ECO:0000313|EMBL:BAV13051.1} OX=1493 OS=Clostridium cellulovorans. GN=Lip1 OC=Clostridium.
Sequence
MLKTKKLVGVAMTLVATLTLSLSSSLFSTLEVKAVDQVTSSETTVVEDTHSNMPLISRSV
PAFSSTSGASNANDNNYGTTWYGTAPGWLAYDLSNVPVEQREKIVLSWYNSDTYDYDSSI
LNTSSYHKPKSYTIEGNSASGGNSAPASGWVVLQTVTNNNYHSREHVLDFSGYNWIRINI
TDSIPGSISINMDIHNAKQGTDDAWIILGDSITAGGTALNGNGKGTIAQIVNSYNPNHYP
LVECGGTGSILSRHLVQNIKSYLSIFPGKYVGVAFGTNDSWGNQTGADNYYNNIEYAVKE
ILAAGKVPIVSKIPWARLNNVSDNVPAYNAKVEAIYSAYPQVIKGPDFWTIFKENQTLIS
GDNVHPSTEGYNRMREAWAETILNVYKNSTVVIKKGDVNNDGKVNAIDLAILKKHLLSGG
LTGDALKASDMNNDSVVNAIDLALLKKILLSQA
Download sequence
Identical sequences A0A173MZQ1 D9SQS3
gi|302875410|ref|YP_003844043.1| WP_010075538.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]