SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZQ8
Domain Number 1 Region: 174-442
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.19e-71
Family Glycosyl hydrolases family 16 0.0011
Further Details:      
 
Domain Number 2 Region: 983-1139
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.67e-33
Family CBM4/9 0.0047
Further Details:      
 
Domain Number 3 Region: 463-630
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.72e-29
Family CBM4/9 0.0044
Further Details:      
 
Domain Number 4 Region: 819-962
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.54e-29
Family CBM4/9 0.0012
Further Details:      
 
Domain Number 5 Region: 640-805
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.48e-20
Family CBM4/9 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173MZQ8
Sequence length 1143
Comment (tr|A0A173MZQ8|A0A173MZQ8_CLOCL) Laminarinase {ECO:0000313|EMBL:BAV13067.1} OX=1493 OS=Clostridium cellulovorans. GN=Lam16B OC=Clostridium.
Sequence
MKTKKIGLVVTLAVAFLLSISSILYLTTKNNVSRDESLNTNTDSKDTEKKTDNKDSQTKI
NNKDKQTKTDNKESLSNDQKSHEVLVNNITESTTANNNGITVEYGENKGVVNNNNNPIIN
GDITTGIDNPIPNKNNDVNNGSNSNGNNNSGDINNGDNNGGTSNNNGTNQDKPLWALAWS
DEFNGNALDKTKWNFDEGNWGVNAEGAPYAGWGNNEKQNYIAGDNNVEVRDGQLIITAKK
EQSYDKYGGPYDYTSAKVKTKDLFSKKYGKFEIKAKLPAGKGLWPAIWMLPEGEKYGQWA
ASGEIDIMEAWGSKMDSVRGTIHYGKAYPNNVQNGKESSQDLEFKKKHPNFKIIDYHTYS
VEWEPNEIRWYIDGDIYQTITNWYSQGVNQPDKYAFPAPFDKNFYLILNLAVGGAWDGDP
DSTTVFPKSMAVDYVRVYEKTKPYDTPVDRSTIKEAYSSDAKLPLGDGNFVYNSNFDKDV
TGADNIIGVPDTAYWSFLNLPSYEGQASVSIEPINNKNFAHIDISNKGNQDYSLQLIQRV
TVGRARGYKLTFDAKSTGDRNISVKIGGDETRGYTAYAGNYTVPLTSEVKTYSYSFNMAS
ETDLKARLEFNVGDDLKGVWIGNVKLEEIEFIRNDNDIKKPLANGQEIYNGTFDLGNTSR
MTYWNINAVNGQANASVNENTRELKLDVYPGYNGVSNISMDQRGLELKEKCTYKVSFKGR
AEGEQGTLANVMSSVTNNKSLQVYLANIDGSIKYSTAKDFTLSKDMKEYSFEFTPTVSDS
NSKMVFDFGGDKKTIYMDDISMIKTKDFVDYSQVGQLFFVQNGDFSDGLNQWDHYIDSAA
DASIIEENGEAKISVNNPGTDIWHVILQQPAAGKTFDMKAGIQYLISFDARATVNREMKV
SLENASYASFLAQTVNLTDKMQNYSFKFTLPSDQQLALKLFMGKLNGAGKAHDVFIDNVK
LEVNGASEEALPKPDNPNNNVNTQKELVSNNSFDSTINPWTLSVANWNGGPGADATAEVE
NSQAKINVKKVGTENWNVQFKLNPLTMTKGHKYKVSFDVKASIQREIELAIQHNGGSYET
FFLTNGIVASPSGNHYEYEFTMDKDTDSEVQFVYNLGKVGNNSEIGEHIVYFDNISLIDE
SVV
Download sequence
Identical sequences A0A173MZQ8 D9SRI6
WP_010076605.1.47838 gi|302875546|ref|YP_003844179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]