SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZR1
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000677
Family Type I dockerin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 198-297
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000254
Family Zinc protease 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173MZR1
Sequence length 374
Comment (tr|A0A173MZR1|A0A173MZR1_CLOCL) Uncharacterized protein {ECO:0000313|EMBL:BAV13059.1} OX=1493 OS=Clostridium cellulovorans. GN=Ukcg3 OC=Clostridium.
Sequence
MKKHKVKCLITSTMVFASLFSSTVITKAEVTSNTSQQNATTTTNQLTLNDMPSNLKSSIE
WVWNNRILKEGSTKRKNLIFDQIYAGKGTLNYIVRWQSNKSVTLQQRKDMATMISRQINN
WTKSLKGYDGWPYGDITVKIVGWACADPSLILNKQSDEIVYTSYITDDLSTTDSSIPTKL
PIAPSSISRFDHFQDSNYSYPGGLDKRFDMYLWGTSNLRGGAGGDWGQRVSDEYILSSLA
SNEAHIIEHEIGHAFSITDFYEDADRPPGGFPTNTIMWAGDSMTITEWDSWMLRYVWSQI
KKDTSRFPATIPVETTYKLGDVNKDGKITALDLAFMKKLILNGTNEADLTLYDMNKDGKF
NALDLATLKRLLLS
Download sequence
Identical sequences A0A173MZR1 D9SS49
WP_010076689.1.47838 gi|302875627|ref|YP_003844260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]