SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173MZS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173MZS7
Domain Number 1 Region: 46-272,307-383
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.57e-38
Family Pectin lyase 0.071
Further Details:      
 
Domain Number 2 Region: 514-574
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000216
Family Type I dockerin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173MZS7
Sequence length 575
Comment (tr|A0A173MZS7|A0A173MZS7_CLOCL) Pectate lyase {ECO:0000313|EMBL:BAV13046.1} OX=1493 OS=Clostridium cellulovorans. GN=Pel1A OC=Clostridium.
Sequence
MLRKKTKKNAFNSKSKRNLVSTSCVLSLILGNVCAYNSSTVYAGTEPTIAFQGADGGGKY
ATGGRGGEVVYVTNLNDSGVGSFRDAVGTSNRIVVFAVGGTIELKSDVVVKSNVTIAGQT
APGGAGITLKNFKIGMGGSNIIMRFISSRPGERGTNADYDAFGGSDGSNSIVDHCSMGWA
NDEQWGLYSANDNATIQYSIVGPSNSFSYHSKGIHGFGIMLGRSNVSWHHNLIVHNVSRN
FRGKVVGTSSAEFTNNIIYNWASQTAYGTLGHLNYVNNTLKKGVSTVGGHNYVSVADSGT
APENYSIYLTGNRFLNSDNSNYSTFTQNNWSGISYGTGKDESNTKSNTPFKLLVNGFDAS
TVPKVESSEASYDHVLEFAGAGITSTQRPAIDQQVATETKTGTGTLTGARPYAEATAEQK
ATIDKYKMQCGVVYQYPKAVLTGAKVDTDKDGMADEWEVARGLNPNSKTTADGKPEANGD
YCGQGYANIEYYINDLTINAFPKGVVTLSPTTKVTVLGDVNKDGKLSALDLAWLKKYILG
GTTLTAEQLKSADMNNDGKANALDLALMTKKILSQ
Download sequence
Identical sequences A0A173MZS7 D9STE7
gi|302873894|ref|YP_003842527.1| WP_010076390.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]