SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173N017 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173N017
Domain Number 1 Region: 47-383
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-68
Family beta-glycanases 0.00000359
Further Details:      
 
Domain Number 2 Region: 396-463
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.71e-20
Family Type I dockerin domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173N017
Sequence length 464
Comment (tr|A0A173N017|A0A173N017_CLOCL) Endoglucanase {ECO:0000313|EMBL:BAV13032.1} OX=1493 OS=Clostridium cellulovorans. GN=Eng5C OC=Clostridium.
Sequence
MNKRSRIAAFITASIMTLGLAMTANSQITKAITSNPSAEKTIVRDNMTTTQLVADMGLGW
NLGNTLESCGSWITGNSVSSYETAWGAPITTKAMIDGVHNAGFNSIRIPVAWSNLMAADY
TISPALLSRVEEVANYALDNNMYVIINLHWDSGWLAGFSTNYDECMKKYKSIWTQLSERF
ANYGDHLIFESLNEEACFNDIWNRWGGTTGKDKAYGIANNINQAFVDLIRSSKGNNPKRH
LLIAGYATDIPLTCDPLYKMPTDPANRCAVSVHYYTPSTFTILEQDADWGKARTTWGTAE
DVAELQNYMNMMKVNFIDKGVPVIVGEYGTNNKNKTTDMVRLYLTSVAKEAYKLGMCPML
WDAGNMVMYDRNACQFKDPQFITEMKTIRDTARPTTQIIYGDLNNDKKVNAIDFALMKKY
ILDNSTPIDLKIADLNGDGKVNALDYAVFKKFLLGQITKFPVQS
Download sequence
Identical sequences A0A173N017 D9STR7
gi|302875932|ref|YP_003844565.1| WP_010075900.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]