SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173N064 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173N064
Domain Number 1 Region: 330-619
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.17e-88
Family beta-glycanases 0.000000609
Further Details:      
 
Domain Number 2 Region: 725-1010
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.61e-87
Family beta-Galactosidase, domain 5 0.00021
Further Details:      
 
Domain Number 3 Region: 9-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-62
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000162
Further Details:      
 
Domain Number 4 Region: 615-716
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 4.17e-24
Family beta-Galactosidase/glucuronidase domain 0.0033
Further Details:      
 
Domain Number 5 Region: 221-328
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 3.74e-20
Family beta-Galactosidase/glucuronidase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173N064
Sequence length 1012
Comment (tr|A0A173N064|A0A173N064_CLOCL) Beta-galactosidase {ECO:0000313|EMBL:BAV13125.1} OX=1493 OS=Clostridium cellulovorans. GN=Bgal2A OC=Clostridium.
Sequence
MKDISPTLDWLENPEIFRVNRIDAHSDHWFYERMDDIKLQDEMPLKQNLNGKWRFSYSEN
PSLRLTDFYKEDFDVSGFDYIEVPGHIQLQGYDKCQYINTMYPWEGHDELRPPHISKSYN
PVGSYVTFFNIKEELKNKQTFISFQGVETAFYLWLNGKFVGYSEDTFTPSEFDITEYLKE
GENKLAVEVYKRSSASWIEDQDFWRFSGIFRDVYLYAVPYTHINDLFVKTDLSDDFKAGT
LNATVKISGNIEGRLEAYLEDSKGNKVTETLTQDISSASSNGELNLSLKIDRVNLWSAEE
PTLYTLYLLIHTKDNVLTEIVPQKVGFRRFEMKDKIMCLNGKRIVFKGINRHEFSARRGR
SITKEDMLWDINFLKQHNINAVRTSHYPNQSLWYRLCDEYGIYLIDEANLESHGSWQKMG
QCEPSWNVPGNLPEWQDVILDRASSMVERDKNHPSILIWSCGNESYAGEDIFQMSEYFRK
KDPSRLVHYEGVFWNREYDKTSDMESRMYAKAADIEKYLNNDPKKPYISCEYMHAMGNSC
GGMMKYTELEDRYSMYQGGFIWDYGDQALYRKTLDGKEVLSYGGDFTDRPTDYNFCGNGI
VYANRVPSPKAMEVKYLYQNIKITPDKNGAIIKNQNLFVNTDKYELYYKVEKEGKLLLEG
KTKVSIAAGEEKHVELPFGEYNCPEEIVFTVSMHLAEDTIWANKGHEIAFGQKVFERKEI
TKTSPDSKLKIVYGDVNIGVHGKDFKVIFSKQYGGIISLRYSNKEFITRTPMPFFWRAIT
DNDRGNRHDFRCAQWLSATYGLKCVDGSIEPHDDKIILNYIYQLPITPTTTVTMSYEVSS
DSTIKVTVAYKGVEGLPELPVLGMNFKLLSEFNTFSWYGMGPDENYIDRCEGAKLGIYES
TPLNNLSKYLVPQECGNRTGTRWVMVKNQKGEGLKFAYEKSPFEFSVLPYSNMELENALH
QEDLPPVNFTHVNIIGKQMGIGGDDSWGAPVLPEFCIDSSKDLEFSFIISNI
Download sequence
Identical sequences A0A173N064 D9SM89
WP_010074094.1.47838 gi|302876876|ref|YP_003845509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]