SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174L0D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A174L0D6
Domain Number - Region: 76-95
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00667
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A174L0D6
Sequence length 111
Comment (tr|A0A174L0D6|A0A174L0D6_BACVU) Uncharacterized protein {ECO:0000313|EMBL:CUP17643.1} KW=Complete proteome OX=821 OS=Bacteroides vulgatus. GN=ERS852509_01327 OC=Bacteroides.
Sequence
MNDIPPDSLALTGEQKNDVRRMASLGYAPEDIAAYLGLDASECFLFVYDAGIPGTTIRGL
IREGVLVSRAAPEIKLHEAAEDGNIDAVKLLTEIQERRLFENLLKDMDEYE
Download sequence
Identical sequences A0A174L0D6 C6ZB08 I8WC77
WP_007848421.1.36284 WP_007848421.1.54640 WP_007848421.1.8648 WP_007848421.1.97168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]