SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174S194 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174S194
Domain Number 1 Region: 680-836
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.55e-31
Family SMI1/KNR4-like 0.0096
Further Details:      
 
Domain Number 2 Region: 9-120
Classification Level Classification E-value
Superfamily TPR-like 0.0000000683
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A174S194
Sequence length 1539
Comment (tr|A0A174S194|A0A174S194_9FIRM) SMI1 / KNR4 family {ECO:0000313|EMBL:CUP91492.1} KW=Complete proteome OX=169435 OS=Anaerotruncus colihominis. GN=ERS852551_02373 OC=Anaerotruncus.
Sequence
MELLEQCQIWNENDEYQKIIDALEAVPAEERTPEMDSELARAYNNLAELGDRELFKKAIA
LLAPHEEYFAGDHCWNFRMGYSYYYLDQEGRALPYFRKALEARPGDEDSQMLINDCEKRI
TLPRFEKCFRERTEAAWEAFAQQEAGLRRFMDEDKNRERGEELIEQCEKILNFAFDEICF
EMGFNGKKHELILTPEGNRVKLFQLVYFQKHAPKEVLEHWNILVGRQSNPNIGLRSGGWE
ISGDDVQLWLEQQGENSFALSAYCEKLLPLLREDENRVWWILTNLTDQVLGEIPHMRYID
SFDMLETPREEPCVLLSKLPDELKGMGLDLSIDPEVLLESYTGYEMKPDENPDADWRLDI
IAGITCCPPFINDYMSAESGCMDDFHADGAAAGFFCYPLDTLRDENGSQKIFDFREKLES
ALLADAGEDAVTLTGGATGLYCGYVDFIAWDLRAVLNAAQEFFDETDLPWASFHVFRRDV
GTVTLKEPAGDKPEDDGFGDEESLDNLEYIPYTPENAEAFYRQLERWNDEDEYTRCITVL
GTIHKDQWDYRAAYAMARALENYAIIGDHEEGTPNFKGDKALLQAIEMLESVREEGQDKA
EWNMRMAYGYQYLHGQEEKAIPYAQRWAELDPEDEDAPAVIRECRQEIRNRQRSRKKKTR
FAPGDTPFEGFDFTDFWDDDEYALKEYVSEPPSDELIASVEEELGYKLPASYICLMKQHN
GGIPANTCYPSDEPTSWADDHIAITGIFGIGREKDYSLCGKLGSRFMIDEWEYPAIGIAI
CDCPSAGHDMIFLDYRDCGPQGEPAVVHVDQENDYKITRLADSFEEFICGLENESVYDMD
EDDDNEDDDTDEEADQDSRGAFAGFVLMSKGSWDKAQFIQDMKAKWDITVEEDEDGGNRD
DAVVFEVGDMIAAVSLMPYPIPDGEAELNAENNYMWPEAVKAAKEHCAHIMVAVLGKEEN
LLERGKFYAKLVAACCRQKYAAGVYTSGVVFEPRFYESFADMMQEDELPIFNWIWFGLYR
NEGGMSAYTYGMEVFGKDEMEVLNTGAEPGELRDFLASLVSYVLENDVELHDGETIGFSA
EDKHTITRSKGVALPDQMTLKISYVSAGDDPEEDDDDSIGMDDASWHMESIEEKELEIDP
INACSHMAIYLRWCIEHDLMEENFLSEHSEVVKQVKADPASVDLRAFIREKLFGCLYSAL
FNQQGRAFAGYYYGEGDSPYFPSDVDDYALQYFGPKRYHSNEFQQEAYLFIPFDEDYYQA
MAKVIDKRFVNWQGQGFDEDTLEPSDVAQAIMEYLDCECTYFPSMKDDDPIMSAYSYARR
LGVREGFIPVLVKPDETLLECLVMNADPENEADCYEFDLKTVTGYRKKILAAPIKDGKAV
LEQLAGQRREEAEDDDLDWAEEVLGEMEGGYDNCRFSCYWDSDTNMTYPLILAKIPVKNP
WDIFAYLPFGNWNECPDTPELMAAAKYWFEQYGAVPAAMTHDELEFELPAPISKEKAMEA
ATEQYGFCPDIVDQEQDDPTVGNLADVLWQSTVWYFWWD
Download sequence
Identical sequences A0A174S194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]