SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174XSH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174XSH8
Domain Number 1 Region: 886-944
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000235
Family SMI1/KNR4-like 0.0061
Further Details:      
 
Domain Number 2 Region: 234-319,732-769,798-851
Classification Level Classification E-value
Superfamily TPR-like 0.000000000119
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A174XSH8
Sequence length 1002
Comment (tr|A0A174XSH8|A0A174XSH8_9FIRM) Protein of uncharacterized function (DUF2185) {ECO:0000313|EMBL:CUQ62683.1} KW=Complete proteome OX=1806509 OS=Fusicatenibacter sp. 2789STDY5834925. GN=ERS852537_06981 OC=Fusicatenibacter.
Sequence
MVTDLAAILLECSVSGSVNLQDLDEYNTPARRIRITATPEEHDAMNKSLADFVHAPLEYD
ISEMMGEDEITDMAYQVEMLRKELYEASGRNRNYHVKAEDVKHLLPDWEGADGCIATNRI
TVEGCKIGYCYREKPDGGWDSGWRFTAGDESEAYMDDPNNAGIYKLNTICNDDPDIIPLL
NTSAPCAFARDENGVFQPEVLEPEEMEEPDMDILEQCQKWHEESKQHKIIDALEAIPAQE
RTPEMDSELARAYNNLADPYKPGGKEMLKKSIALLKPHEEYFAGDHYWNFRMGYSYFYLD
QEGRALRYFEKALEARPDDEETMQLIDGCRKGISLPQFSACFRERTENWWEAFAEMEAEL
RQMMDEDKDHTRGAELVAQMEDTLNLVFDEISFEIGVGGEKHELILTPEGDKVKLFELVY
FQKHAPKEVLEHWNILVGRQPLQNIGLHTEDGWDISGDDVQIWLEEQGENSFAISAYCEK
LLPMLREEEGRAWWMLTTLTDQVLGEIPHMRYIDSFDVLEEPKAEPSFLLSQLPDKLKEK
GADLSTDPNAYLESYLGYKMEPNEDPDADWRLDTMVGSTCCVPLINGYLNADNDFMDDLH
ADGAVAGFFCYPLDTLREEEGSQKIFDFRDKLEEVFTTDEGSEVLTLTGGATGLYCGYVD
FIAWDIREALNMAKEFFEGTDIPWAIFHTFRREAGSVPLKQQDDGTETENQDDELDETLM
GMDYIPYTQQNAEAFFAQLEQWNDEDEYTRCIQALNAIPEDWRNYRTAYALARALENYAI
IGDHDEGTLKSKGDKALLRAIEVLESVREEGQDKAEWNMRMAYGYQYLYGQEEKAIPYAQ
RWAELDPEDENAPAVIRECKAEIRKRQRSRKKAKFVPGDTPFEGFDLTNFWDDNWYALKE
YVSDPPSDELIASVEEELGYKLPAAYIWLMKQHNGGIPVNTCYPCDEPTCWSDDHVAITG
IFGIGREKSCSLCGEIVASAILHSFASDDMERNCASSACLVR
Download sequence
Identical sequences A0A174XSH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]