SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175JIR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JIR8
Domain Number 1 Region: 262-407
Classification Level Classification E-value
Superfamily Flavoproteins 2.9e-36
Family Flavodoxin-related 0.0035
Further Details:      
 
Domain Number 2 Region: 4-292
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.52e-35
Family ROO N-terminal domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A175JIR8
Sequence length 413
Comment (tr|A0A175JIR8|A0A175JIR8_ENTHI) Type a flavoprotein putative {ECO:0000313|EMBL:GAT93322.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_159860 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MTSKVLEVLPGLYWVGVMDYELKNYDVLYPAPYGSTYNSYLLQTQEGNVLFETVKQEFAN
ECLDKIEQVIGKEDCIDYIIVDHSEPDHSGSLSPILKRYPNATVIASTAALNNIQFIGHI
RDDTKTINSVKTKQLNLGDIHLKFIYQPFLHWPDTMITLIEEMNVLVTCDMFSTHFADER
MFDDLIVDRKDQYLQISYDYFNSVFGPFKRFVLKGIQTLENQPGFDLKNCKAICCSHGPI
IRGYIPERVELWRQWAQPPPLKNKVVIAYGSVYGYTETMANTIAAGIKSVGVEVSMHNVE
NTSVENVLKDFSDCKGLLLGTPTIVGDALPPILTIACNLNPYIHCQRFIQCFGSHGWSGE
GVGNLSARLQQLKAKQPVEPLSCRLQPGQEKLEECFEWGKKFGLAIKEEDEEN
Download sequence
Identical sequences A0A175JIR8 C4LX61 M2Q6D3 M3TD14 M7W2D1 N9UYT3
gi|56468393|gb|EAL46241.1| gi|67471351|ref|XP_651627.1| XP_651627.1.49425 294381.C4LX61 jCVI|EHI_159860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]