SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175JL46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JL46
Domain Number 1 Region: 348-546
Classification Level Classification E-value
Superfamily HCP-like 6.15e-24
Family HCP-like 0.0019
Further Details:      
 
Domain Number 2 Region: 8-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.03e-19
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 638-761
Classification Level Classification E-value
Superfamily HCP-like 5.1e-17
Family HCP-like 0.005
Further Details:      
 
Domain Number 4 Region: 554-633
Classification Level Classification E-value
Superfamily HCP-like 0.00000133
Family HCP-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A175JL46
Sequence length 775
Comment (tr|A0A175JL46|A0A175JL46_ENTHI) Actin binding protein putative {ECO:0000313|EMBL:GAT94357.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_038800 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEDPYICIITNWLNYTLKSCYKKKITYASFKDGVLLQILFNKLNNNISNPLKLPQSSADK
INYNQQIINIVYGGVNKISAEKFTLGAPEAVTPLLIKMFLKYQLKCSSIQEAIDKILNMV
QSVVGKEVTDLSLSWVDGTLFNQFITGLQPATNNSFKNLNKLTSVELIQQCLEYAEDTFN
VPPLITAEDMCNLQEQFSLVVYFSYFMNYAKKVPRKRVIIMDEAKSNKIKKIIDSPEPEL
DLKISSYVAIEGQLKKEAEPIVEEIIEDNPYTLSVQINILKNFNIFDQNPRKEEDADSWR
RINKFSYWIEPIMSNFLYESPMILYSPQQRTEEERKRILVTDKTRPETFFKLASCYFQGI
LVEKNEKLAYKLFKYGARYGDVNSINNIGLMKERGIGCVQDKYIAREKYVEAMTKGCVIA
CNNLAVLQMIEGNVEKAISNWKFAITKNVVAACNNLGVALIQSDPNKAVNLLMEGYNCDD
KYATYNLGVIALKGISGFVPQNLCVAGALFQNSINLPYSRFNVAFMQYTGIGLQKNLHEA
AKNYALSRCSKTHSDVNLAIGLLYGHLGVKSEDSQEIATKILLAQRKSSVATFHLGMCYR
KGIGVDENSIKSAEMYKLSMKLGNEFAKFHVGCVKMIKHENREEAMTLIKEAVDAGYWVA
ESWYGRFIYAFNKREGLRLIRNACIMEDKRALYALAIHLLKNQDVNHAIEILFRLCKLNY
VDAIVTVGVCFMKGVGVKKDVNAACVLWRKAKALGSDKAVQFLQYCYSDEDEFYY
Download sequence
Identical sequences A0A175JL46 C4LZQ3 M2QFG4 M3UR65 M7W8A4 N9TDQ5
XP_656868.1.49425 jCVI|EHI_038800 gi|56474094|gb|EAL51482.1| gi|67483170|ref|XP_656868.1| 294381.C4LZQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]