SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175JS58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JS58
Domain Number 1 Region: 116-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-91
Family Protein kinases, catalytic subunit 0.00000032
Further Details:      
 
Domain Number 2 Region: 6-98
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-26
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A175JS58
Sequence length 433
Comment (tr|A0A175JS58|A0A175JS58_ENTHI) Ph domain containing protein kinase putative {ECO:0000313|EMBL:GAT96268.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_042150 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEEKTQGWLMKEGGSWKSWKKRYFELNNDSLYYYKEQDKKTLMGIINLSLATHITAVDNY
HKKYENIIRICTPSRTFHLSAANEEDRLLWLTSIICHSQQSNIYKSKITTETVTQKDFDV
KCLLGKGAYGKVFLVEMISTHEIFAMKTIEKKQIIEYEEIEHTMSERRILSKLHHPFLVN
LYYSFQTPTHLFYIIDYCPGGEFYYYLQKNGKVSEEDAKFYSAQILLAIEHLHSSNIVYR
DIKPENILIGADGYLRLTDFGLSKENVTKENTTSTFCGTPEYLAPEVVVGKDYSEPVDWW
GFGILIYEMIHGHAPFTSEDIQQLFQKIIHDPVIFPNVSYPTADCKRCIQELLVKDPEKR
LTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDIINETAKIDEGEVV
DSKDYFNDFTYCK
Download sequence
Identical sequences A0A175JS58 C4M4G9
gi|56473752|gb|EAL51161.1| gi|67482395|ref|XP_656547.1| XP_656547.1.49425 jCVI|EHI_042150 294381.C4M4G9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]