SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175JT33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JT33
Domain Number 1 Region: 29-292
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.1e-31
Family Calponin-homology domain, CH-domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A175JT33
Sequence length 946
Comment (tr|A0A175JT33|A0A175JT33_ENTHI) Uncharacterized protein {ECO:0000313|EMBL:GAT96588.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_154330 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MNSDYPATFPERYEVKDPLILEADSQIDREKVQLVSWLNKELLTDKKITQEYKYMPIKEE
GNDFFYALSDGVIVKHIINKFYNQYNIDVKYGKAGLISKNANITNVIKIANIILSKGVTI
SESNLSTPNKTTASLVLGFIWMLFDKFQEKDIKLSMKEKGVDVSMEEFLLNWVNKALEEE
GVDKRINNFGSDIKDSEAYLYLLHHLNNNCSLEALNSSNLIVRATSVLENANLLNAGSFV
EPQEIVSGDSTKNFRFVTNLYQTVNAPKKEISNEEYQDEEEIRKKNEEKEQKLQEEREAE
EKRKKEEEEKKTKVEKMKEVDQLKEEVIKKEKQKKADEIHQKLDEEEQKLAEAQAEIEEK
KALKAKVDDLILLSKVQDSKDEKEASKNLIQAQRETKKAEIEQQKQEEELSRQEEVLRNL
IEQKKKEAESIDSIASLDNTQVAELTQNVNQENIQIKEELNKTKEDVNTAKSDLVAMQQK
TLQAEIDNEETKKELDATTKRLLAEQERKQERIEREKQTVNEMNAKIEMFETMNDELMKT
VQTQKDEIITKTDTLTDIESTNLENKKKEKKMMMNIEKQFKLLEQQKTLHKKNLAKKEKL
RSETQKLENEKKVVQADIKTITMERESTENRADNLLTKQDELNEKLIDAENANVDADSEL
QDEQEKLDQMNEEIQMKLEHQEFIEIQKLKNDKKSKEDEKKKLEKERKKKRSEAKKAKEE
LIKLAEQQKEYERQKKDLEDRKKENEERLKEIEERGKKEEETAAQFEERMAALKQQKEQL
IAKQKEVEEKEMTDKKRMERLKRKREEAKQLKEAGIEVSEPTMDDVVKEEEERAKRHRHS
ETSSRRRKTEEPREEVKTDKSPNEEKTGDVVADSLEERRRKREEERKAREERRAKRAAES
NGESKSENTTTETKQESSEERRKRREEREAQREKERAERRARLSNK
Download sequence
Identical sequences A0A175JT33 C4M596 N9TL01
jCVI|EHI_154330 XP_650448.2.49425 294381.C4M596 gi|169801604|gb|EAL45059.2| gi|183233384|ref|XP_650448.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]