SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175JWW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JWW5
Domain Number 1 Region: 103-371
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.76e-44
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A175JWW5
Sequence length 377
Comment (tr|A0A175JWW5|A0A175JWW5_ENTHI) Ph domain containing protein kinase putative {ECO:0000313|EMBL:GAT97938.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_197790 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSTVKQIQTGYIVKEGSNVKSWKKRWFVFTTDGNISYYTNRQETCKKGEVDMRHAIKAIK
VNGKKLMIEIHFDSSRVFRLKFDDEEVEERWYKSFIEFIEDNKTSQNGFSRYEEIDLNNF
NIGNTIMQTDKGSVQTVIYTRTQIKYSMKTLLKLTLNSEEIEYIESIHNSLKLTECPYLC
RTCLSFQSENLHFVMNEYPTKKLSEIMNSSILPIPRVKFYATELLLAINALHKCNYIHME
INPETVLITDDGHIFLTTPVGLRASYKCGYNYFAPELLEKKQPTAAVDYWSYGILLFAMA
FGEAPFYDTNPSTVCKKIISEPINFPYNTFPEVESFVTELLVKDPSKRNCDFEALKLRPF
FVGINFDQFQKKEVSPQ
Download sequence
Identical sequences A0A175JWW5 C4M8K1 M2RTU9 M3TKE4 M7WVA3 N9UWW4
jCVI|EHI_197790 gi|56467483|gb|EAL45440.1| gi|67469697|ref|XP_650826.1| 294381.C4M8K1 XP_650826.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]