SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177REW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177REW1
Domain Number 1 Region: 6-266
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.81e-32
Family Acetylcholinesterase-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177REW1
Sequence length 289
Comment (tr|A0A177REW1|A0A177REW1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OAI57824.1} KW=Complete proteome; Reference proteome OX=1799659 OS=Verrucomicrobiaceae bacterium SCGC AG-212-N21. GN=AYO49_01800 OC=Verrucomicrobiaceae; unclassified Verrucomicrobiaceae.
Sequence
MAVHRDIAYAEPKNERQCLDVYAAKENEGGKSKSDGVVVVWIHGGGWRQGDKSQMAVGKP
EQHTAKPQAIVDRGGVFVAINYRFVPNVNLQTMTGDVAKAIGWVKRNVAQYGGDPSKIIV
MGHSAGAQLAALVCTDERYLAAEGMTLRDIKGCMPVDGGSYYVPLQVEAQEPDKAARLRH
AFPEGSEKELSSVLYIGPNKDKGIPPFLVLCLADRIEANTKVQSQILVHYLNQAGIAARL
VAVSGKTHPTINADLGVEGEEVTREMMGFVEEVAAGRGSSNHKVQSTGR
Download sequence
Identical sequences A0A177REW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]