SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177UU06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177UU06
Domain Number 1 Region: 269-360
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000291
Family UAS domain 0.053
Further Details:      
 
Domain Number 2 Region: 464-586
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000031
Family UBX domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A177UU06
Sequence length 640
Comment (tr|A0A177UU06|A0A177UU06_9BASI) Uncharacterized protein {ECO:0000313|EMBL:OAJ19043.1} KW=Complete proteome; Reference proteome OX=117179 OS=Tilletia walkeri. GN=A4X09_g2662 OC=Exobasidiomycetes; Tilletiales; Tilletiaceae; Tilletia.
Sequence
MSVPSEAQQAILLTSLRAHLRATSPSSSSAASQDGQQQPYEDDDILRSLLAVEDWNVSRA
VALFKQSIGGDATAGGGGSATPSTEDDAATARRIQQMEIDDSNVGGIGETLRTERAPLWN
GGQQLYRRTAGGTGGGRVGLSYGGTGTNNPFAEDDRLQHARGAAAAAAAGQPPNGWPSIW
NILYQTLTLPFSIAQGLLLFLLRLLRIRPGGGVGGSGGGSGSVSRHHPSAGTRMTIDARA
AAEQYIRDLEHDLAESTNGVESGSQQQRSKTYPPLFVGSYSQACQRAKDELKVLAIVLTS
IDNPNSDIFRRQTLTDPSLVEVLSRPEFLVWAGDIREREAWQVADMCDATTFPFVAFVSL
QPSRTSRSSSSLSSSSSTTPRLAVLSRHSGTALVKPTPATAARQLQEHLTGLLVPRVQPY
LSRLGTERARLASERALRAEQDAAFERAAQADVARVRARREAEQRREEEERKKREEETRR
EEEKRRLESWRSWARARLVPAEGVAESEDEKILIQFRLPGGRSLSRSFGLDDELEGVFAY
IETASLVGGSAEGVGASGPPQGYEHAYGFELVLGGYPRRKVTPAEINSTSNGKTRLRDVA
GLNDARRANVIVEGSVAGMSITSGGQAPQDGDDSSGEDSD
Download sequence
Identical sequences A0A177UU06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]