SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178DCK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178DCK1
Domain Number 1 Region: 13-60,189-271
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-22
Family Regulator of G-protein signaling, RGS 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178DCK1
Sequence length 385
Comment (tr|A0A178DCK1|A0A178DCK1_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OAL38921.1} KW=Complete proteome OX=856822 OS=Fonsecaea nubica. GN=AYO20_01672 OC=Fonsecaea.
Sequence
MAHPGSRGEDVEVRNRLPTLMEVLGRRTLAPVDLFSFYIYMRDQQRSVDYLDFWLDVSQH
MSLCRHYVRELRRSMLVDTPEMEKTTTSKRSSALLDQFELGEGIDARKSGQESRVSAILR
SDNGAAGAKPPRSRGEGGGATDHSPSHSLGSANSRNLSRPSGDRPSPSELPQPTYSTPEV
RTDSNSPGHSVARADIKASAEKILYTFVLPGSEREIVLPDTMLNRIIRAIEEEGRDDPEV
FDDAKDYVFQAMERDAFPGFLQAKALGNLVPLSVLIRLAIGLASLMAGFWAGYYMILRDR
SRATRCWLILPFTIGCYFLVSYQYKLDIVAAYLGFSEYTWMNWSRVREPFVRRLLLTRAT
MAFLMFAAAAVALSVLFIFVPGTRF
Download sequence
Identical sequences A0A0D2GVF0 A0A178DCK1
XP_013288741.1.45204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]