SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178M6F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178M6F7
Domain Number 1 Region: 236-504
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.06e-67
Family Thermolysin-like 0.00000346
Further Details:      
 
Domain Number 2 Region: 643-725
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000824
Family Collagen-binding domain 0.035
Further Details:      
 
Domain Number 3 Region: 1140-1242
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000209
Family Collagen-binding domain 0.021
Further Details:      
 
Domain Number 4 Region: 517-632
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000017
Family Collagen-binding domain 0.025
Further Details:      
 
Domain Number 5 Region: 1386-1487
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000432
Family Collagen-binding domain 0.027
Further Details:      
 
Domain Number 6 Region: 1263-1345
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000131
Family Collagen-binding domain 0.028
Further Details:      
 
Domain Number 7 Region: 891-998
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000157
Family Collagen-binding domain 0.019
Further Details:      
 
Domain Number 8 Region: 766-870
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000915
Family Collagen-binding domain 0.023
Further Details:      
 
Domain Number 9 Region: 1021-1133
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000981
Family Collagen-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178M6F7
Sequence length 1772
Comment (tr|A0A178M6F7|A0A178M6F7_9CHLR) Bacillolysin {ECO:0000313|EMBL:OAN44123.1} KW=Complete proteome OX=1707952 OS=Chloroflexus islandicus. GN=A6A03_02955 OC=Chloroflexaceae; Chloroflexus.
Sequence
MRRRWLLTWSWLTVTVLIVWQAAAILAIAPAAHGAPLAEQPQRVFVDAVIAPHPALAGAL
PSVLADDPKAVALDFLRGPGASLVATANDLNWVPLRSEQVDNVTVVRVAQYKGAVPIWGA
DLALQVAGNTVRSLSGAFVPSVAADTKPALNLDEAVKIATLALQNNPPRHDDEELVVLAE
AFAKPRLDEHELVFFNPALFELGDSATALAYRLVLTAPDESASATVVVDALTGKVWLSFS
NYHSGKNRIIRDANGVNTTGGTTCYTESGPSGTVHPDCTAAFTNTGLTYDYFFNTFGRDS
FDNAGAAMIAVVRYGTVANAFWNGYVTAFGPGFATRDVVAHEWSHAVTQYTADLIYNGQS
GALNESFSDVFGAMVDRDDWLMGEDTPIGALRSMANPPAYSQPDRVGNYVCTTSDNGGVH
INSGIPNKIAYLMSDGGTFNGRTVTAIGRNATERIFYRALTAYLTSSATFADMYNALLAA
AGALYGTSSTQYQSTLNAAQAVELNVLPSCGGTATPDSYEPDNSASTAKPITVNGSAQSH
NFHVAGDQDWVTFTAVSGNTYIIQTSGLQSNADTVLALFGNNGTLLLAQNDDYGGTFASR
ISWLATASGPLHVRVTNFANRGGVNTGYNLTVTSDPSSTTPDAYEPDNTLSTAKPITIGG
AAQRHNFHVAGDQDWVRFSATAGSTYVIETLNLGPASDTVLELYDGSGNRLAQNDDYGGT
YASRIQWYTPSAANLFVKVRHYRSSAYGAATVYDLRVTLIPSPVGDSYEPDNSLGAAKPI
TVNGAAQTHTFHIAGDQDWVYFDTVASSASYVIETFNLAAGNDTVLELYNSSGALLAYND
DYSGLASRIGFTTSSAQRFFVKVRHYSSSAGHSGLRYDIRVTGVPATTPDSFEPDNTAAT
ARAITPGTLDAPNVTRHNFHVAGDQDWVRITTTAGNFYLFETANLDDRADTVITLFEPNG
TTVIAENDDGGGGWASRLTWYAPASDTYYLRVRHYSSGVGGERTGYDLRIGAYGTPATPD
AYEPDNTLATAKPISVGGSQQHNFHAVGDQDWVYFDAVNGIEYTLTTSHLGTRSDTVLEL
YNSSGSLLAYNDDYSGLASRIIWTATANGRFFVKVRQYNSTIYGANTDYRLNLASAAPDA
YEPDNTLATARPITVNGAAQTHTFHVAGDQDWIFFGATAGYSYRIETLNLASCSDTVLEL
YNSSGALLAYNDDGGGGWASRIDWVAPSSANFYVKVRHYSSAAYGSCTAYDVRVTSSGIV
GDAYEPDNTLSTAKPIIVNSAAQRRNFHIAGDQDWVYFDVNAGNRYVMRTFNLGSCSDTV
LELYNSGGVLLAQNDDGGGGLASRIDYTAPANARLYLKVRHYNPYTSGACTQYDLEVTST
SLNPDAYEPDDTMAQARSFTVNGAGQDHNFHSTTDVDWMVFTAAGGSTYTIYTYNLGAEA
DTVLELYNSSGTLLTYNDDGGGGWASRIVWTAPSSGPFFVKSRPYGSTGGLPTATYSFRI
VIGGTLSDAELAGHLPVSLITVQNEAVNGDQLRLVGITVDVVPQPGQEFTTLVQAVGRAA
SYKLVVTPKSDLVELLAIEPLDPAGQPLAEGAWMAQEVGRGDLSVTTGWQSDQPATLLRL
RWRLRATLAEKQLLLPVQVLATDGNGVFWQSSAQVAVPTVASSAKIDTVDPAMVTISSTA
TLSLRVIGLEGELPKAYLVDLNGQNEQQFAAIAYAPGSADTLIASFDPSFKPGLYKVRLD
LSNGSQLFSETVVRLLAPGERVYTVYVPATSR
Download sequence
Identical sequences A0A178M6F7
WP_066789618.1.7451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]