SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182I6W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182I6W4
Domain Number 1 Region: 9-129
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.8e-31
Family Rap30/74 interaction domains 0.00015
Further Details:      
 
Domain Number 2 Region: 186-251
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.18e-23
Family DNA-binding domain from rap30 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182I6W4
Sequence length 272
Comment (tr|A0A182I6W4|A0A182I6W4_ANOAR) Transcription initiation factor IIF subunit beta {ECO:0000256|PIRNR:PIRNR015849} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSKEAEAIRVDKELDLSNAGRGVWLVKVPKYIANKWEKAPGNIEVGKLKISKQVGQKAQV
SLTLSDAVINIDPAEEIPRDHRLDVSVVTKQTLGVFSHAVTTTRDDPVPECEKQYMEGRI
VQKLECRPYADHCYMKMKLESIRKASQPARQVKSLEKIVHNYKPVSDHKHNIEDRERKKA
EGKKSRDDKNAVLDMLFNAFEKHQYYNIKDLVRITRQPISYLKEILKEVCDYNMKNPHKN
MWELKKEYRHYKEDDKKDDDTTKDTMSDSDSD
Download sequence
Identical sequences A0A182I6W4 A0A182L3F9 A0A182XQN8 Q7QIP9
XP_308768.3.40869 7165.AGAP007002-PA AGAP007002-PA AGAP007002-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]