SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182QHP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182QHP4
Domain Number 1 Region: 104-147
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.00000000000314
Family Chemosensory protein Csp2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182QHP4
Sequence length 149
Comment (tr|A0A182QHP4|A0A182QHP4_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AFAF010383-PA} KW=Complete proteome; Reference proteome OX=69004 OS=Anopheles farauti. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MFRFTTSLLPCPFFAQTEYDKIAVYSTGTDEIKSSDKGARMTYEKKPPARTMESVPSTKR
NRSTKGFLDVVFLASPIPNPDRMVRSLLRDFAAHDFFRELGEAALPEVIQRNCRNCSPQQ
AQNAQKLTNFLQTRYPEVWAMLIRKYGAV
Download sequence
Identical sequences A0A182QHP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]