SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182QWM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182QWM8
Domain Number 1 Region: 509-671
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.26e-68
Family A middle domain of Talin 1 0.0000173
Further Details:      
 
Domain Number 2 Region: 678-801
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.01e-52
Family I/LWEQ domain 0.0000413
Further Details:      
 
Domain Number 3 Region: 2306-2495
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.11e-51
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 4 Region: 771-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.02e-45
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1854-1984
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.98e-32
Family VBS domain 0.00044
Further Details:      
 
Domain Number 6 Region: 205-319
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-30
Family Second domain of FERM 0.00000657
Further Details:      
 
Domain Number 7 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.19e-29
Family alpha-catenin/vinculin 0.033
Further Details:      
 
Domain Number 8 Region: 320-410
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-25
Family Third domain of FERM 0.0000449
Further Details:      
 
Domain Number 9 Region: 1482-1562
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000196
Family I/LWEQ domain 0.01
Further Details:      
 
Domain Number 10 Region: 2021-2144
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000173
Family VBS domain 0.034
Further Details:      
 
Domain Number 11 Region: 1594-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000188
Family VBS domain 0.042
Further Details:      
 
Domain Number 12 Region: 963-1061
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000019
Family I/LWEQ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182QWM8
Sequence length 2916
Comment (tr|A0A182QWM8|A0A182QWM8_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AFAF018348-PA} KW=Complete proteome; Reference proteome OX=69004 OS=Anopheles farauti. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSTLSLRISLEGGRVTKTIQFDPSTTVFDACRIIKDKFAEAVQGQAQEFGLFLADDDTRQ
GVWLEPARNLGYYMLHNHDVLEYRQKHRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDPEPQNENQPDNRSNTGTLTLRRKAQEKERDTKMESLRKKLRTDDE
INWVDVGKTLREQGIDEQETVLLRRKFFYSDQNIDSRDPVQLNLLYVQARDAILDGTHPV
TQDKACEFAGIQVQIQFGDHNDAKHRPGFLDLREFLPASYVRTKNIERKVFAEHRKHIGQ
SELEAKYVYTKTARELPTYGVTFFLVKEKMTGKNKLVPRLLGVTKDSVLRLDETTKEILK
SWPLTTVRRWGASPNTFTLDFGDYADQYYSVQTTEAEQIVQLIAGYIDIILKKKQAKDHF
GIEGDEGSTMVEESVAPSKATFLQHEETNKSGKVETHSIAKPAIMRGTDGERPYGTGEMQ
SIQYGAIVGQVNLAHQPPMLQQTRVSSVLSEPQRALLGYISAGQDALNRAEKELETRVQL
PPLGTDPGSLQWREETLDTSKQTVTTHLATMNAATAQVVTASQPDEIDHEAVGAAVSQIT
QSIPEVTKEVRLIAALMDDDCTGDKLLEATRKLCNAFSDLLRSAEPESKEPRQNLLNAAT
RVGEASGQVLSTIGEESVESRELHDMLLGLAKAVANTTAALVLKAKSIAAVTEDEATRNR
VIGAASQCALATSQLVACARVVAPTIQSPACREQLEAAAREVAKAVAHLAEVCNEATDNQ
QLRGDLTAAAKDVSKSLTDLLEHIKLSAREKARRVENENPVDNVLVATDILVSSTDPQEM
IHQAQQLGKATAQLIQSIKGEAESQHDSNMQRKLLEAAKQLADATARMVEAARLCAGNPY
DSAHQETLRAAAEELRVITTSTANTPAIKRQLIGRLEQCAKQAASSATQCITAAQNSLVH
SNDVQTKEILLQDCQAVADQIPRLVAGVKNTLSRPDDPNAQLGLIDAAEMFLEPGAQMAG
SARELQPTVMDQAAAQQLGRCSVNLTHAIHDLRQAAHRAREACGGNELDAALEAVRNMRN
VLNDTRRAAQEGSLRPLPGETADSCFKQLAAASNAVDVSMHQLLSAAQQGNRQYAGVAGR
DTALALGDYTKSVRGVLVTTKNPAVVDCADEVIVDALRVIEEAQRTLQNLDHQEALLIAI
KRTKHSLGRTIDCLPGVKDINEAYETMGELRTILDTGEYPPSERAYGQLQNELKAAADQL
NVAGGQVAQAYDSSIKLAGTSQEFCHAYKELLTVTLEMAGQTVEDRAREEIVTSLRGVSN
QSTSLLGTARYVAGDPDRPNAKGELSSAARLVTESINRLVDVCTQAAPGQKECDGAIRSI
ESLRPLLESPQESLTDQGYFDCLETVLEKSRTLGEGMTGIANNAKNSKHVEFGHSVNSVS
ESIRGLIESAAQAAYLVGVSNPTSVGGRPGIVDQAQYARASQAIRQSCDVLRGQASSQPQ
VLSAATVIAKHTSALCNACRNASSTTTNPVAKRHFVQAAKEVANSTAALVREIKALDQDY
SPSSRQRCAAATEPLLEAVSSLCHFASSPEFVSIPARISTEGRKAQEPILAAGRGILDGA
VDMVRTAKVLAVTPTDPPVWQQLATHSRNVSESIKQLASSIREKAPGQMQCDQVLEVLKD
CSRELNSAALAVGVDGLPQRKDSNLQGFTNQSLNAASELIDRLEPVKSSAKKNAESLGHA
VNQIAKHIVPLTNGVIGACSQLVHSGQQTVLINQVKSVVECCAQLVQTAKQAGGNPRAAH
FHPELDEAVEATREAIQELNATVERLSTENGVVTGLMEQISRSMSRISDKRQSFLGASLN
DTYVDYQTRMVQSAKEIARYANEINAKAAIDPSKLAQLCVEMTHHYTQLAQDAIGASALT
TTPDVAIRIRNTVQDLGRSVNVLIQSTTGIRKDDSSGLVEISRGARDVSEKVAQVLAALQ
AGSRGTQACINASSTVSAIITDLDTTIMFATAGTLESTDEDGKFSDHREHILKTAKALVE
DTKILVAGAAGTQDQLAAAAQNAVTTILQLADAVKHGAASLGSGQPDSQVMVINAVKDVA
AALGELINATKLASGKPINDPAMNDLKDSAKVMVMNVTSLLKTVKAVEDEHTRGTRAMEA
TVDAISQELRSMQFAPEMMRSSMQQLSRPEDLISVTKHVTAATAKAVAAGTSNLQADIAA
AANLGRKTISDMLSVCKSVAWSCAETPELRQRTLDAGSAVAVAYRDLLEGILNHCTADER
MQLSRRVAMCVTDLVGMAQLLKGSDWVDPDDPTVIAENELLGAAASIEAAAKKLANLRPR
RQEVKEADENLNFDEMILEAAKSIMAASSSLVRAANAAQRELIDQGKVAKRPLTSSDDGQ
WSEGLISAARLVAAATHSLVEAAQNLVQGVGTEEMLISSAKQVASSTAQLLIACKVKSDP
NSETGRRLQAAGNAVIKSTDKLVQAAQQAIEGEEEHTLRLNRNMVDGMAQEINARSEILM
RERQLEEAKNKLIAIRHAKYRQKLGGGGFTTDESDEGGIAPPPFAGYGQSTSPKPPQTLP
KPGTYSPSSFGTVSPAHQGASTMPRLGQQHTTSPGSPSSFQRSGTGNQLLTANAVPKPYQ
SDALKSPSALVSPSMLNRSYDMTRVENSNLSASKFNRTQFDSAVQDLQSKVQPLSTFRSS
PTHPAHTNGGSSSPAPQTYEGFTTRYETRVFPNANNTNPQSPNPLTSVEQKLAKLNLENH
DLQQQQQQQQQQRYHHQQSLSQGNNNITATPPAQSTTNLTSSFASPAANVTNVSPQQQQY
QQQQQHHQQQQHFLRTSSTTNTSSTVPTAIKNGNVSLFDSGAHDAATTLSKTMVEQQHQQ
HQQQQVIHTKKIHMTSSSTTSTTMKSSTGGTVTEWK
Download sequence
Identical sequences A0A182QWM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]