SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182W6I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182W6I8
Domain Number 1 Region: 581-883
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.28e-51
Family Rhodopsin-like 0.00071
Further Details:      
 
Domain Number 2 Region: 2-284
Classification Level Classification E-value
Superfamily L domain-like 6.35e-46
Family Internalin LRR domain 0.0065
Further Details:      
 
Domain Number 3 Region: 353-510
Classification Level Classification E-value
Superfamily L domain-like 2.27e-19
Family Ngr ectodomain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182W6I8
Sequence length 1201
Comment (tr|A0A182W6I8|A0A182W6I8_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMIN005954-PA} KW=Complete proteome; Reference proteome OX=112268 OS=Anopheles minimus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MLPNLEELILSHNKLDHINSEAFFGLSNLKKIALQSCGLVRVPMEALRRIRTVTTLYLDN
NLIADTENVTFRGFHFLKNLRLEGNLLQRVPTDALIGLRSLEALNLGNNLLTIIRERDFP
VLDNLYMLILRRNQISEITSGALTNLTRLKVLDVDDNSLSSVPVGLENLMMLQEISASNN
RIRWISKGDFPKNLVSLDLKSNPLAGIKPGALQNMPRLRKLILSDVRGLNELPPLDGCTS
LEVLRLDRANLSKIPDHICKTSPRLRSLDLKSNILLSIPNVTNCLCAHSTRPLAFPANEQ
DDGKSRRKLHFSLLSTLVSPRHHLPVLFRNQPPLRNGGYALLRTFNGIQTNRDLASNRIS
SLHGAPFSSLGQLHDLLLSNNEIESIPHDAFIGLVRLQVLDMESNQVFFIHPDAFRPLKK
LEDLNLGNNLFPQLPTAGLERLLHLKTFNNPHLREFPPPEAFPRIQTLVLSYAYHCCSFL
PLTTALPKVPNTFNIRENVLFPTDNEFDMSLWNNSYNDIWPQLQNLSKKFGNQINDLLNV
YGAEYGSYPGGHVPTFPDEYFEDELGITHASPTAQPGAIQCLPEPGPFLPCQDLFDWWTL
RCGVWVVFLLAMLGNGTVVFVLIFSRSKMDVPRFLVCNLAAADFFMGIYLGFLAVVDAST
LGEFRMYAIPWQMSAGCKLSGFLAVLSSELSVYTLAVITLERNYAITHAMHLNKRLSLRH
ASYIMTVGWTFAITMAVLPLLGVSDYRVFAVCLPFEIQKGTGSLAYVVFLMFINGVAFLI
LMGCYLKMYCAIRGSQAWNSNDSRIAKRMALLVFTDFICWSPIAFFSLTAVFGLHLISLE
QAKVFTVFILPLNSCCNPFLYAILTKQFKKDCVLICKAIEESRVTRGIGRCRHSSNFSNR
HTPANTNSLVERSSKELPPLLPGQTCNCSAKLMEQETARLRFHHHQQQQQQHHLRQGVLV
RTWRRLMLCSWGTAEERNRRGRGRNGDQYAYQIAEIQQKQHKRAGSVSSSENFSSSRSDS
WRNAQHHCGIPLRLLDPRRRHTSWLITRKTSQDSNLSSSRNDSSGSTATQSTGTWRISRS
SGSTSVVLPGVRVDGVGHPIPSTARQSIPGGKPRLVRQSAVQEDTQELSCSPPRLGVRFL
PTIPSAADSSVQLDDETAEAASPTSSQSGNQPAPAPFYAILHGTGHPQATVSSLKDKTKP
P
Download sequence
Identical sequences A0A182W6I8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]