SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182X3R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182X3R7
Domain Number 1 Region: 509-671
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 6.41e-69
Family A middle domain of Talin 1 0.0000171
Further Details:      
 
Domain Number 2 Region: 678-801
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.02e-52
Family I/LWEQ domain 0.0000443
Further Details:      
 
Domain Number 3 Region: 2356-2545
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.85e-51
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 4 Region: 771-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.14e-47
Family I/LWEQ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1854-1984
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-32
Family VBS domain 0.00046
Further Details:      
 
Domain Number 6 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-31
Family alpha-catenin/vinculin 0.048
Further Details:      
 
Domain Number 7 Region: 205-319
Classification Level Classification E-value
Superfamily Second domain of FERM 6.15e-31
Family Second domain of FERM 0.00000619
Further Details:      
 
Domain Number 8 Region: 320-410
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-25
Family Third domain of FERM 0.0000474
Further Details:      
 
Domain Number 9 Region: 1479-1562
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000118
Family I/LWEQ domain 0.01
Further Details:      
 
Domain Number 10 Region: 1596-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000204
Family VBS domain 0.044
Further Details:      
 
Domain Number 11 Region: 2021-2135
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000377
Family VBS domain 0.023
Further Details:      
 
Domain Number 12 Region: 963-1060
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000902
Family I/LWEQ domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182X3R7
Sequence length 2833
Comment (tr|A0A182X3R7|A0A182X3R7_ANOQN) Uncharacterized protein {ECO:0000313|VectorBase:AQUA004444-PA} KW=Complete proteome; Reference proteome OX=34691 OS=Anopheles quadriannulatus (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSTLSLRISLEGGRVTKTIQFDPSTTVFDACRIIKDKFAEAVQGQAQEFGLFLADDDTRQ
GVWLEPARNLGYYMLHNHDVLEYRQKHRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDPEAQNENQPDNRSNTGTLTLRRKAQEKERDAKMESLRKKLRTDDE
INWVDVGKTLREQGIDEQETVLLRRKFFYSDQNIDSRDPVQLNLLYVQARDAILDGTHPV
TQDKACEFAGIQVQIQFGDHNEAKHRPGFLDLREFLPASYVRTKNIERKIFAEHRKHVGL
SDLDAKYEYTKTARELPTYGVTFFLVKEKMTGKNKLVPRLLGVTKDSVLRLDETTKEILK
SWPLTTVRRWGASPNTFTLDFGDYADSYYSVQTTEAEQIVQLIAGYIDIILKKKQAKDHF
GIEGDEGSTMVEESVAPSKATFLQHEETNKGGKVETHSIAKPAIMRGTDGERSYGTGEMQ
SIQYGAIVGQVNLAHQPPMLQQTRISSVLSEPQRALLGYISAGQDALNRAEKDLESKVQL
PPLGTDPGSLQWREETLDTSKQTVTTHLATMNAATAQVVTASQPDEIDHEAVGAAVSQIT
QSIPEVTKEVRLIAALMDDDCTGDKLLEATRKLCNAFSDLLRSAEPESKEPRQNLLNAAT
RVGEASGQVLSTIGEESVESRELHDMLLGLAKAVANTTAALVLKAKSIAAVTEDEATRNK
VIGAASQCALATSQLVACARVVGPTIQSPACREQLEAAAREVAKAVAHLAEVCNEATDNQ
QLRGDLTAAAKDVSKSLTDLLEHIKLSAREKARRVENENPVDNVLVATDILVSSSDPQEM
IRQAQQLGKATAQLIQSIKGEAESQHDSNMQRKLLEAAKQLADATARMVEAARLCAGNPH
DSGHQEMLRTAAEELRVITTSTANTPAIKRQLIGRLEQCARQAASSATQCITAAQNSLIH
SNDVQTKEILLQDCQAVADQIPRLVAGVKGTHARPDDPNAQLCLIDAAEMFLEPGAQMAG
SARELQPTVMDQAAGQQLGRSSVNLTHAIHDLRLAAHRAREACGGNELDAALEAVRNLRS
VLSDTRRAAQEGSLRPLPGETADSCFKQLAAASNAVDVSMHQLMSAAQQGNRTYAGVAGR
DTALALGDYTKSVRGVLVTTKNPAVVDCADEVIVDSLRVIEEAQRTLQNLDNQEALLIAI
KRTKHSLGRTIDCLPGVKDINEAFETVTDLRSILDTGEYPPSDRPYGQLQNELKSAADQL
NVAGGQVAQSYDSSIKLAGTSQEFCHAYKELLTVTLEMAGQTAEDRAREEIVNSLRGVSN
QSIGLLGTARYVAGDPDRPNAKNELSSAARLVTESINRLVDVCTQAAPGQKECDGAIRSI
ESLRPLLESPQESLTDQGYFDCLDTVLEKSRTLGEGMTGIANNAKNSKHVEFGHSVNSVS
ESIRGLIESAAQAAYLVGVSNPTSVGGRPGIVDPAQYARAAQAIRQSCDVLRGQASSQPQ
VLSAATVIAKHTSALCNACRNASSTTTNPVAKRHFVQAAKEVANSTAALVREIKALDQDY
SPASRQRCAAATEPLLEAVSSLCHFASSPEFISIPARISTEGRKAQEPILTAGRGILDGA
VDMVRTAKVLALTPTDPPVWQQLATHSRNVSESIKQLASSIREKAPGQMQCDQVLEVLKD
CSRELNSAALAVGVDGLPQRKDSNLQGFTNQSLNAASELIDRLEPVKSSAKKNAESLGHA
VNQIAKHIVPLTNGVIGACSQLVHSGQQTVLINQVKSVVECCAQLVQTAKQAGGNPRAAH
FHPELDEAVESTREAIQELNATVERLSTENGVVTGLMEQISRSMSRISDKRQSFLGASLN
DTYVDYQTRMVQSAKEIARYANEINAKAAIDPSKLAQLCVEMTHHYTQLAQDSIGASALT
TSPDVAIRIRNTVQDLGRSVNVLIQSTTGIRKDDSSGLVEISRGARDVSEKVAQVLAALQ
AGSRGTQACINASSTVSAIISDLDTTIMFATAGTLQSSDEDGKFSDHREHILKTAKALVE
DTKILVAGAAGTQDQLAAAAQNAVTTILQLADAVKHGAASLGSGQPDSQVMVINAVKDVA
AALGELINATKLASGKPINDPAMNDLKDSAKMIRELCLTETSTSVALAGYRAEGVGQRYI
YTHQQQTHTTATTALSARAPTVMVMNVTSLLKTVKAVEDEHTRGTRAMEATVDAISQELR
SMQFAPEMMRSSMQQLSRPEDLISVTKHVTAATAKAVAAGASNLQADIAAAANLGRKTIS
DMLSVCKSVAWSCAETQDLRQRTLDAGSAVAIAYRDLLEGILSHCTADERMQLSRRVAMC
VTDLVGMAQLLKGSDWVDPDDPTVIAENELLGAAASIEAAAKKLANLRPRRQEVKEADEN
LNFDEMILEAAKSIMAASSSLVRAANAAQRELIDQGKVAKRPLTSSDDGQWSEGLISAAR
LVAAATHSLVEAAQNLVQGVGTEEMLISSAKQVASSTAQLLIACKVKSDPNSETGRRLQA
AGNAVIKSTDKLVQAAQQAIEGEEEHTLRLNRNMVDGMAQEINARSEILMRERQLEEAKN
KLIAIRHAKYRQKLGGGFTTDESDEGGVAPPPFAGYSQPTSPKPPQTLPKPGTYSSGSLG
ASPAQGASTMPRLGQHSPASPSFQRPGSGNQLLTANAVPKPYQSDALKSPSALVSPSMLN
RTYDTTRVENTNLSASKFNRTQFDAAVQDLQNKVQPLSTFRSSPTHTNGGVAGSSPAPQT
YEGFTTSGAHDAATTTLRSVQGGGSKLMTTEEQYQQHQQVIHTKKVHMSSTTSSSSSTTL
KSGSAGGAVTEWK
Download sequence
Identical sequences A0A182X3R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]